SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000014341 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000014341
Domain Number 1 Region: 331-633
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 7.42e-54
Family Rhodopsin-like 0.00051
Further Details:      
 
Weak hits

Sequence:  ENSPCAP00000014341
Domain Number - Region: 3-33,132-216
Classification Level Classification E-value
Superfamily L domain-like 0.00034
Family Ngr ectodomain-like 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000014341   Gene: ENSPCAG00000015350   Transcript: ENSPCAT00000015340
Sequence length 691
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_5401:21338:80236:1 gene:ENSPCAG00000015350 transcript:ENSPCAT00000015340 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSNLPNISRIYSIDSTLQRLESHSFYNMSKMTHXXXXXXXXXXXXXXXXXXXXXXXXXXG
IFNTALKVFPDLTHVSNDVFFILXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXYLNKNKHLTAIDKDAFGGVYSGPTLLDISYTSVSDLPSRGLQNLKELI
ARNTWTLKKLPLSLSFAHLTRADLSYPSHCCAFKNQKKIRGILESLMCNVSSIRSLRQRR
SVNALNGPFYQEYEDDAGDISAGYNKNTKFQDTRSNSHYYVFFEEQEDEIIGFGQELKNP
QEEALVAFESHYDYTVCGDSENILCTPKSDEFNPCEDIMGYKFLRIVVWFVSLLALLGNV
FVLFILLTSHYRMTVPRFLMCNLAFADFCMGMYLLLIASVDLYTHSEYYNHAIDWQTGPG
CNTAGFFTVFASELSVYTLTVITLERWYAITFAMRLDRKIRLRHACAVMAGGWVCCFFLA
LLPLLGISSYAKVSICLPMDTETPLALAYIVLVLLLNIVAFIIVCFCYIKIYVTVRNPQY
NPGDKDTKIAKRMAVLIFTDFICMAPISFYALSALMNKPLITVSNSKILLVLFYPLNSCA
NPFLYAIFTKAFQRDVFILLSKFGICKRRAQAYRGQRVSPKNGTGIPMKRITRAKRQSLP
NMPDDYELIENSYLTRNQQGQISEQHKQTVL
Download sequence
Identical sequences ENSPCAP00000014341 ENSPCAP00000014341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]