SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000014357 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000014357
Domain Number 1 Region: 50-221,285-324
Classification Level Classification E-value
Superfamily L domain-like 2.53e-22
Family Ngr ectodomain-like 0.033
Further Details:      
 
Domain Number 2 Region: 575-663
Classification Level Classification E-value
Superfamily Fibronectin type III 2.18e-17
Family Fibronectin type III 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000014357   Gene: ENSPCAG00000015370   Transcript: ENSPCAT00000015357
Sequence length 736
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_2757:5979:13518:-1 gene:ENSPCAG00000015370 transcript:ENSPCAT00000015357 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCWALLLLLLLLPPSIAGPTQERVPLFRLVQEGPRPEGGSNATGSPCEGVPAAEAVSVTV
ANRSLERLPGCLPLALRSLDGSHNLLRVLSGQELRALSQLQVLTLRHNLVAELRWGPGGP
AGLHTLDLSYNRLAALPRCAPGTALGSLRELHLAGNPLRALQPRAFSCFPALRFLNLSST
TLGGDSVQEAIAEAAFAGADGGALGTLEVLDLSGTLLTHXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCNLSSFRPWTLN
ASQVLSINLYGNPLTCSCELSWLVLDANRIILKXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEPVILLDDYSEEGRKEVEGTSH
DVTCDYHPCKHLQTPCEELQRRSQCRCLGLSGEDTVPDPPKLQGVSEVTDTSALIRWCAP
NSVVHEYQVRYQPEGQAEAWEVVGQVHAAARQHPLSGLAPATTYRVCVLAANRAGPSPLR
TSAWRRPCTAFTTRISSALVLAALGTCCGLLLLSTLVLAACLYRRARVPHMERHHTHLVA
YKNPAFAYPLRLTVTQ
Download sequence
Identical sequences ENSPCAP00000014357 ENSPCAP00000014357

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]