SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000014436 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000014436
Domain Number 1 Region: 32-256
Classification Level Classification E-value
Superfamily L domain-like 1.7e-37
Family Ngr ectodomain-like 0.0028
Further Details:      
 
Domain Number 2 Region: 279-358
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000487
Family I set domains 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000014436   Gene: ENSPCAG00000015501   Transcript: ENSPCAT00000015440
Sequence length 493
Comment pep:known_by_projection scaffold:proCap1:scaffold_8477:5567:7048:1 gene:ENSPCAG00000015501 transcript:ENSPCAT00000015440 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPQRDLRGLWHLLLSLFLFLFEVSKAGRPVVSCPAACLCASNILSCSKQQLPNVPHSLP
SYTALLDLSHNNLSRLRAEWTPIRLTHLHSLLLSHNHLNFISSEAFSPVPKLRYLDLSSN
QLQTLDESLFSELQELEVLLLYNNRIMEVDRSAFDGMTQLQKLYLSQNLISRFPLELVKE
RAKLPKLMLLDLSSNKLKSLPLSDLQKLPGWFKNGLYLHNNPLQCDCDLYQLFSHWQYRQ
LSSVMDFQEDLYCMNSKKPHNVFNLSFLNCSEYKERAWEAHLGEKLTIKCDTKHQGMTKV
WVTPSNERVLEEVANGTVRVSEDGSLFFQSVQVEDGGVYTCYATGETFNETLSVELKVHN
FTLHGHHDTLNTAYTTLVGCILSVVLVLIYLYLTPCRCWCRGVEKPSSHQGDSLSSSMLS
TTPNHDPMAGGDKDDGFDRRVAFLEPTGPGQGQNGKLKPGNTLPVPEATGKGQRRMSDPE
SVSSVFSDTPIVV
Download sequence
Identical sequences ENSPCAP00000014436 ENSPCAP00000014436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]