SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000014514 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000014514
Domain Number 1 Region: 257-284
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000777
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000014514   Gene: ENSPCAG00000015573   Transcript: ENSPCAT00000015523
Sequence length 284
Comment pep:known_by_projection scaffold:proCap1:scaffold_11588:17715:33123:-1 gene:ENSPCAG00000015573 transcript:ENSPCAT00000015523 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLMFDPVPVKQEAMDPVSVSYPSNYMEPMKPNKYGVIYSTPLPDKFFQTSEGLSHGIQME
PVDLTVNKRSSPPSAGNSPSSLKFQSSHRRASPGLNIPSSSPPMKKYSPPPAGVQPFSVP
LSMPPVMAAALSRHGIRSPGILPVIQPVVVQPVPFMYASHLQQPLMVSLEEMENSNSSMQ
VPVIESYEKPMLQKKIKIEPGIEPQRTDYYPEDMSPPLMNSVSPPQALLQENHPSVIVQP
GKRPLPVESPDTQRKRRIHRCDYDGCNKVYTKSSHLKAHRRTHT
Download sequence
Identical sequences ENSPCAP00000014514 ENSPCAP00000014514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]