SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000014516 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000014516
Domain Number 1 Region: 3-318
Classification Level Classification E-value
Superfamily L domain-like 2.07e-59
Family Internalin LRR domain 0.027
Further Details:      
 
Domain Number 2 Region: 1204-1294
Classification Level Classification E-value
Superfamily PDZ domain-like 1.46e-21
Family PDZ domain 0.0000126
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000014516   Gene: ENSPCAG00000015469   Transcript: ENSPCAT00000015525
Sequence length 1297
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_2014:3007:97682:1 gene:ENSPCAG00000015469 transcript:ENSPCAT00000015525 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLFNCQSLHKLSLPDNDLTALPASIANLINLRELDVSKNGIQEFPENIKNCKVLTVVEAS
VNPISKLPDGFSQLLNLTQLYLNDAFLEFLPANFGRLTKLQILELRENQLKMLPKTMNRL
TQLERLDLGSNEFTEVPEVLEQLSGLKEFWMDGNRLTFIPGFIGSLKQLTYLDVSKNNIE
MVEEGISACENLQDLLLSSNSLQQLPETIXXXXXXXXXXXXXXXXXXXXXXXXXLTSIEE
LDCSFNEIEALPSSIGHLNNIRTFAADHNYLQQLPPEIGSWKNITVLFLHSNKLETLPEE
MGDMQKLKVINLSDNXXXXXXXXXXXXXXXXXXXXXXXXSKPLIPLQKETDSETQKMVLT
NYMFPQQPRTEDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEGNLKRY
PTPYPDELKNMVKTVQTIVHRLKDEETNEDSGKDLKPHEDQQVVNKDMGMKXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXESEDLSS
DEEMKMAEMRPPLIETSTNQPKVVALSNNKKDNTKDEDSLSDEATHNSNQNNSNCSSPSR
MSDSVSLNTDSSQDTSLCSPVKETHTGINSKIRQEDENFNSLLQNGDILSSSTEEKLKVH
DKKDFNLPEYDLNIEEQLVLIEKGVASAATTDESHKFDHLNMNLNKLVTNDAFQPQTKEG
SKAQDIVLGIGFLNINSKEEVVHLENGNNCSNLESMTKLNGRSEETPQSPRRTEPFDTDC
SVDVEISKSTEDLSQXXXXVLFDQPLQVFTGSSSSSDLVSGTKTIFKFDSNHNPEEPNTM
RGPTACGPQSTLQTYGLPQYNIQYSSCNSSATAKDTLWHSKQNPQTDHVSFPPQRLPRSE
SIESHGYVKHSANTNFSNHNNARANTSYHLNQRLGPARHGEMWAISPNDRLNPAVTRPTI
QRQNSVSSTASTNLGDPGPTRRAQIPEGEYLSYRELHSVGRTPLLSGSQRPLSARTYSMD
GPNAPRPQSARPSVTEIPERTMSVSDFNYSRTSPSKRPNARVGSEHSLLDPPGKSKVPHD
WREQVLRHIEAKKLEKKNPQTSSPGDPCQDDVFISGQQNYSSATLSHKDVSQDSLMKXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKVAYQPPYTQPHCSPRQGH
ELAKQEIRVRVEKDPELGFSISGGVGGRGNPFRPDDDGIFVTRVQPDGPASKLLQPGDKI
IQANGYSFINIEHGQAVSLLKTFQNTVELFVVREVSS
Download sequence
Identical sequences ENSPCAP00000014516 ENSPCAP00000014516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]