SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000014566 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000014566
Domain Number 1 Region: 55-158
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-31
Family Spermadhesin, CUB domain 0.00063
Further Details:      
 
Domain Number 2 Region: 259-370
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.15e-26
Family Spermadhesin, CUB domain 0.0014
Further Details:      
 
Domain Number 3 Region: 450-488
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000017
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 4 Region: 164-200
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000288
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 5 Region: 411-449
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000013
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 6 Region: 212-254
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000144
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 7 Region: 374-411
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000746
Family LDL receptor-like module 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000014566   Gene: ENSPCAG00000015609   Transcript: ENSPCAT00000015578
Sequence length 860
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_4215:9810:49911:-1 gene:ENSPCAG00000015609 transcript:ENSPCAT00000015578 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARRWSTKESPRWRSALVLLFLGGVYXXXXXXXXXXXXXXXXXXXXCGEAPEQIRAPSGI
ITSPGWPSEYPAKINCSWIIRANPGEIITISFQDFDIQGSRRCNLDWLTIETYKNIESYR
ACGSTIPPPYISSQDHVWIRFHSDDSVSRKGFRLAYFSGKSEEPNCACDQFRCGNGKCIP
EAWKCNTMDECGDSSDEEICAKDANPPTAAAFQPCAYNQFQCLSRFTKVYTCLPESLKCD
GNIDCLDLGDEIDCDVPTCGQSLKYFYGTFNSPNYPDFYPPGSNCTWLIDTGDHRKVILR
FTDFKLDGTGYGDYVKIYDGLEENPRKLLRVLTAFDSHAPLTVVSSSGQIRVHFCADKVN
AARGFNATYQVDGFCLPWEIPCGGNWGCYTEQQRCDGYWHCPNGRDEINCTMCQKEEFPC
SRNGVCYPRSDRCNYQNHCPNGSDEKNCFFCQPGNFHCKNNRCVFESWVCDSQDDCGDGS
DEENCPVIVPTRVITAAVIGSLICGLLLVIALGCTCKLYSLRMFERXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXASVLENLRLAVRSQLGFTSIRLPMAGRSS
NIWNRIFNFSRSRHSGSLALVSADGDEVVPGQGASRDPERNSTHRSLFSVEPDDADTENE
RRDTAGASGGVAAPLPQKVPPATAVEATVAACGSSSTQSTRGGSTDNGRDVASVEPPSVS
PARHQLSSALSRMTQGLRWVRFTLGRSSSVNQNQSPLRQLDNGVNGREEDDDVEMLIPVS
DGASDLDVSDCSRPLLDLASDQRQGFRQPISATNPGARPSSRSDGPCERCGIVHTAQVPD
TCLETTLKNETSDDEALLLC
Download sequence
Identical sequences ENSPCAP00000014566 ENSPCAP00000014566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]