SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000014569 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000014569
Domain Number 1 Region: 345-528
Classification Level Classification E-value
Superfamily NTF2-like 2.16e-55
Family NTF2-like 0.00000199
Further Details:      
 
Domain Number 2 Region: 81-175
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 8.97e-34
Family Non-canonical RBD domain 0.0002
Further Details:      
 
Domain Number 3 Region: 179-332
Classification Level Classification E-value
Superfamily L domain-like 1.56e-29
Family mRNA export factor tap 0.00000569
Further Details:      
 
Domain Number 4 Region: 525-591
Classification Level Classification E-value
Superfamily UBA-like 5.1e-24
Family TAP-C domain-like 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000014569   Gene: ENSPCAG00000015537   Transcript: ENSPCAT00000015581
Sequence length 595
Comment pep:novel scaffold:proCap1:scaffold_12736:11613:32711:1 gene:ENSPCAG00000015537 transcript:ENSPCAT00000015581 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AEYKNCSGTSQGRYCDEENIHYKHSGYGPSSHFQENDRNTSMRDTHGDLPVKGTSPRRVT
LHDEDHIRITVWKSRKPPKKKVEENEQEESFGSWFKVTIPCGRKYDRIWLLDSIQSQCSV
PFTPVDFHCIEMQVQFFVQDINAASAIKNISYKIHDEKNQKICIFVRPSTAPYSVRYKLT
PEQMEQLKLTMNKRYDVLKQALDLQSLRYDPDLVGYDIDMILNRRNCMAATLKIIEENFC
ELLSLNLRNNKLYQLDGLSDIIALDPKVKILNLSNNELKSVWELDKIKWLKLEELWLEGN
PLCNNFSNQSAYVSAVLQCFPKLRCLDGQQLSLPHAVETEAPDTMKTCKESYKGPEALKN
LIWQFLQQYYLIYDYGDRRSLLAAYHDEACFSLTIPFNAEDPDPISLEKYSKLSRNMKRC
KDPLRDQLLKHTKHDVVDFISVLPRTQHDFNSFVVDVCVQTEKMLCFSVSGVFKEGEGMC
QPHLLAFTRFFIATPGRNSSLCIVNDQLCVRDISRMETQGAWSTPVPTPSSSCIPTLSRE
QWEMVQAFSTQSKMNLEWSYRCLEDNEWNYTRAQQIFTMLQAEGKIPEEAFKQSL
Download sequence
Identical sequences ENSPCAP00000014569 ENSPCAP00000014569

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]