SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000014857 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000014857
Domain Number 1 Region: 390-509
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 7.19e-19
Family Mannose 6-phosphate receptor domain 0.0066
Further Details:      
 
Domain Number 2 Region: 67-108
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000798
Family LDL receptor-like module 0.0049
Further Details:      
 
Domain Number 3 Region: 208-256
Classification Level Classification E-value
Superfamily EF-hand 0.0000233
Family Polcalcin 0.067
Further Details:      
 
Weak hits

Sequence:  ENSPCAP00000014857
Domain Number - Region: 126-209
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0345
Family FCH domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000014857   Gene: ENSPCAG00000015838   Transcript: ENSPCAT00000015883
Sequence length 524
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_6886:32570:42389:1 gene:ENSPCAG00000015838 transcript:ENSPCAT00000015883 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWLLLSLLLPLCSAVEVKRPRGVSLSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXTAACPNGNFHCTNTGYKPLYIPSSRVNDGICDCCDGTDEYNSGIVCENTCKEKG
RKERETLQQMAEVTREGFRLKKILIDDWKKAREEKQKKLTELQEGKKSLEDQVETLRTVK
EEAEKPEKEAKDQHRKLWEEQQAAAKAQEQELAASAFQELDDDMDGMVSVAELQTHSELD
TDGDGVLSEAEAQALLRGDSQTDATAYDHVWAVVRDKYRSEAMPTEQPALGTDLTEPKEE
QLPPMPSPPLEEEEEEEEPEEEEEEEEEEEPEEALPPQVPPVPASPSEEDKMPPYDEQTQ
AFIDAAQEARNKFEEAERSLRDMEESIRNLEQEISFDFGPDGEFAYLYSQCYELTTNEYI
YRLCPFKLVSQKPKQGGSPTNLGTWGSWAGPEHDKFSAMKYEQGTGCWQGPNRSTTVRLL
CGKETVVTSTMEPSRCEYLMELMTPAACPEPPPELPGDSEHDEL
Download sequence
Identical sequences ENSPCAP00000014857 ENSPCAP00000014857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]