SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000014959 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000014959
Domain Number 1 Region: 375-569
Classification Level Classification E-value
Superfamily L domain-like 2.64e-36
Family Ngr ectodomain-like 0.0082
Further Details:      
 
Domain Number 2 Region: 46-140
Classification Level Classification E-value
Superfamily L domain-like 0.000000000311
Family Ngr ectodomain-like 0.051
Further Details:      
 
Weak hits

Sequence:  ENSPCAP00000014959
Domain Number - Region: 787-901
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00118
Family beta-sandwich domain of Sec23/24 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000014959   Gene: ENSPCAG00000016038   Transcript: ENSPCAT00000015987
Sequence length 967
Comment pep:known_by_projection scaffold:proCap1:scaffold_5156:20841:23787:1 gene:ENSPCAG00000016038 transcript:ENSPCAT00000015987 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHGCCPSVTLEQDLHRKMQSWILQTVALTVTSLLLSCAETIDYYGEICDNACPCEEKDGI
LTVSCENRGIISLSEISPPRFPIYHLLLSGNLLNRLYPNEFVNYTGASILHLGSNVIQDI
ETKGFHGLRGLRRLHLNNNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXALVGEVVCETPFRLHGRDLDEVSKQELCPRKLISDYEMRPQTPL
STTGYLHTTPASVNSVATSSSAVYKPPLKPPKGTRQPNKPRVRPTSRQPSKDLGYSNYGP
SIAYQTKSPVPLECPTACTCNLQISDLGLNVNCQERKIESIAELQPKPYNPKKMYLTENY
IAAVRRTDFLEATGLDLLHLGNNRISMIQDRAFGDLTNLRRLYLNGNRIERLSPELFYGL
QSLQYLFLQYNLIREIQSGTFDPVPNLQLLFLNNNLLQAMPSGIFSGLTLLRLNLRSNHF
TSLPVSGILDQLKSLIQIDLHDNPWDCTCDVVGMKLWVEQLKAGVLVDEVICKAPKKFAE
TDMRSIESELLCPDYSDVVVSTPTPSSIQVPARTSVVTPAVRFNSTGGPAGLGAGGSVSS
SVPLSVLILSLLLVFIMSVFVAAGLFVLVMKRRKKNQSDHTSTNNSDVSSFNMQYSVYSG
SGGAGGHPHAHVHHRGPALPKVKTPAGHVYEYIPHPLGHMCKNPIYRSREGNSVEDYKDL
HELKVTYSSNHHLQQPPPAQQQQQQQQHAQQQHPQQQHPQQLQLQPGDEERREGHHMRSP
AYSVSTIEPREDLLSPVQDADRFYRGILEPDKHCSTTPAGNSLPEYPKFPCSPAAYTFSP
NYDLRRPHQYLHPGAGDSRLREPVLYSPPSAVFVEPNRNEYLELKAKLNVEPDYLEVLEK
QTTFSQF
Download sequence
Identical sequences ENSPCAP00000014959 ENSPCAP00000014959

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]