SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000015132 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000015132
Domain Number 1 Region: 422-681
Classification Level Classification E-value
Superfamily YWTD domain 7.19e-47
Family YWTD domain 0.0000000587
Further Details:      
 
Domain Number 2 Region: 258-292
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000249
Family LDL receptor-like module 0.00067
Further Details:      
 
Domain Number 3 Region: 163-200
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000406
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 4 Region: 45-83
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000785
Family LDL receptor-like module 0.00095
Further Details:      
 
Domain Number 5 Region: 336-414
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000251
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 6 Region: 204-239
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000038
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 692-732
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000343
Family EGF-type module 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000015132   Gene: ENSPCAG00000016120   Transcript: ENSPCAT00000016167
Sequence length 948
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_5015:30153:111398:-1 gene:ENSPCAG00000016120 transcript:ENSPCAT00000016167 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRPERGALRPLAVMLLLLLLLLLRLQHLAEAAAADPLRSGQEPVKECEEDQFRCRNERC
IPSVWRCDEDDDCSDNSDEDDCPRDCADSDFTCDGHCIPXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCAPHEFQCSNRSCLA
AVFVCDGDDDCGDGSDERGCAGPACGPREFRCGGDGGACIPERWVCDRQFDCEDRSDEAP
ELCGRAGPGATAAPAACAAASQFACRSGECVHLGWRCDGDRDCKDKSDEADCXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLNECLHNNGGCSHICTDLKIGFECTC
PAGFRLLDQKTCGDIDECEDPDACSQICVNYKGYFKCECHPGYEMDTLTKNCKAVAGKSP
SLIFTNRHEVRRIDLVKRDHSRLIPMLKNVVALDIEVATNRIYWCDLSYRKIYSAYMDKA
SDPAEQEVLIDEQLHSPEGLAVDWVHKHIYWTDSGNKTISVATVDGGRRCTLFSQDLSEP
RAISVDPLRGFMYWSDWGYQAKIEKSGLNGADRQTLVSDNIEWPNGITLDLLNQRLYWVD
SKLHQLSSIDFSGSNRKMLISSTDFLSHPFGVAVFEXXXXXXXXXXEAIFSARLNGLEIS
VLAENLNNPHDIVIFHELKQPRAADACELSAQPNGGCEYLCLPAPQTSTHSPKYTCACPD
TMWLGPDMKRCYRVPPSTSTTTLASTTSRTVATTTGAPGTNAHGPTYHNHSTEMPQLATA
IPSAISIPRAPGISPSTASPATSNHSQHYGNEGGKMGSTVTAAVIGIIVPMAVIALLCMS
GYLIWRNWKRKNTKSMNFDNPVYRKTTEEEDEDELHIGRTAQIGHVYPAAISSFDRPLWA
EPCLGETRELEDPAHALKELFVLPREPRSQLHQLPKNPLSELPVVKCK
Download sequence
Identical sequences ENSPCAP00000015132 ENSPCAP00000015132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]