SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000015163 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000015163
Domain Number 1 Region: 47-169
Classification Level Classification E-value
Superfamily L domain-like 1.49e-25
Family Ngr ectodomain-like 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000015163   Gene: ENSPCAG00000016246   Transcript: ENSPCAT00000016201
Sequence length 257
Comment pep:known_by_projection scaffold:proCap1:scaffold_137859:574:1347:1 gene:ENSPCAG00000016246 transcript:ENSPCAT00000016201 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPLGRQSPSTLQVPRGGPCLLLLFCLPLRAACPQGCQCPEHAGVVAVHCSASGLREVPK
DIPTDAVLLKLDANQITRIPDGAFQHLSQLKELDLSGNSIETIGPATFAGLSGGLRLLDL
SHNRIRRIPKDALDKLSAQVRLSHNPLHCECALQEALWGLRLDPDSADAIACHTSVREEF
VGKPLIQALDAGVSFCSAHHRTTDVAMLVTMFGWFTMVIAYVVYYVRQNQEDARRHLEYL
KSLPSTPVSKDPISPAP
Download sequence
Identical sequences ENSPCAP00000015163 ENSPCAP00000015163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]