SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000015246 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000015246
Domain Number 1 Region: 550-821
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.9e-86
Family Eukaryotic proteases 0.00011
Further Details:      
 
Domain Number 2 Region: 483-514
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000995
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 3 Region: 448-481
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000249
Family LDL receptor-like module 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000015246   Gene: ENSPCAG00000016255   Transcript: ENSPCAT00000016288
Sequence length 822
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_1205:29025:60424:-1 gene:ENSPCAG00000016255 transcript:ENSPCAT00000016288 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRAEAPHAAGGQSDGGDGEEAEPEGMFKVTANSKRKAQDYLRLAPLWLALVLLALVGVL
LWYFLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRDLIASTHL
GPYYNSSSVYSFGEGPFTCFFWFTLQIPEHRRLMLGPDVVQALLVEELLSTANSSAAVPY
RAEYQVDAEGLVILEASVKDIVALNSTLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLCGLRTLQPYAERIPVVATAGIT
INFTSQTSLTGPGVQVHYGLYNQSDPCPGEFLCSVNGLCVPACDGIKDCPNGLDERNCVC
RATFQCQEDSTCVSLSRVCDRQPDCLNGSDEEQCLEXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXCKDGSDEQSCDCGIQGPSGRIVGGAVSSEGEWPWQASLQVRGRHICGGALIADRW
VITAAHCFQEDSMASPALWTVYLGKVWQNSRWPGEVSFKVSRLLLHPYHEEDSHDYDVAL
LQLDHPVVRSATVHPVCLPARSHFFEPGLHCWITGWGALREGAAGMGITAPXXXXXXXXX
XXXXXPTSNALQKVDVQLVPQDLCSEAYRYQVTPRMLCAGYRKGRKDACQGDSGGPLVCK
EPSGRWFLAGLVSWGLGCGRPNYFGVYTRITGVIGWIQQVLT
Download sequence
Identical sequences ENSPCAP00000015246 ENSPCAP00000015246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]