SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000015398 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000015398
Domain Number 1 Region: 83-221
Classification Level Classification E-value
Superfamily L domain-like 2.66e-36
Family Ngr ectodomain-like 0.0031
Further Details:      
 
Domain Number 2 Region: 312-428
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.0000000000000022
Family Hormone receptor domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000015398   Gene: ENSPCAG00000016402   Transcript: ENSPCAT00000016449
Sequence length 1321
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_4522:30497:137687:-1 gene:ENSPCAG00000016402 transcript:ENSPCAT00000016449 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPPGRWRGRAPPPPLPPPLLLLPLALLALLGGGDGGAGALPAGCKQDGRPRGAGRAAGA
AEGKVVCSSLELAQVLPPDTLPNRTVTLILSNNKISELKNGSFSGLSLLERLDLRNNLIS
SIDPGAFWGLSSLKRLDLTNNRIGCLNADIFRGLSNLVRLNLSGNLFSSLSQGTFDYLGS
LRSLEFQTEYLLCDCNILWMHRWVKERNITVRDTRCAYPKSLQAQPVTGVKQELLTCXXX
XXXXXXXXXXXXXXXXXXXXXXXXXCMASYIDQDMQLLWSQDGRIVETDESQGIFVEKNM
IHNCSLIASALTISNIQAGSTGNWGCHVQTKRGNNTRTVDIVVLESSAQYCPPERVVNIK
DFTWPRTLAGITAYLHCTRNTHGSGIYPGNPQDERKAWRRCDRGGFWADDDYSRCQYAND
VTRVLYMFNQMPLNLTNAVATARQLLAYTVEAANFSDKMDVIFVAEMIEKFGRFTKEEKS
KELGDVMVDIASNIMLADERVLWLAQREAKACSRIVQCLQRIATYRLANGAHVYSTSSPN
IALEAYAIKAAGFTGMTCTVFQKVAAADRTGLSDYGRRDPDGNLDKQLSFKCNISNTFSS
LALKNTVVEASIQLPPSLFSPKQKREVRPTEDALYRLQLIAFRNGKLFPATGNSTHLADD
GKRRTVVTPVILTKIDGVNVDTHHVPVNVTLRRIAHGADAVAAQWDFGLLNGQGGWKSDG
CRILYSDENITTIQCYSLSNYAVLMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXLIRISLKSWHMLVNLCFHVFLTCVVFVGGVTQTRNASVCQAVGIILHYSTLAT
VLWVGVTARNIYKQVTKKTKRCQDPDEPPPPPRPMLRFYLIGGGIPVIVCGITAAANIRN
YGSRPHAPYCWMAWEPSLGAFYGPASFIAFVNCMYFLSIFIQLKRHPERKYELKEPAEEQ
QRLAASENGEVLHQDSLSLSLISTSVLENEHTFHCQLLGASLTLLLYVALWMFGALAVSL
YYPLNLVFSFFFGATCLSFSAFIMVHHCVNREDVRLAWIMTCCPGRSSYSVQVNVQPPSS
SGTNGEAPKCTNSSAESSCTNKSVSSFKNSSQGCKLTNLQAAAAQCHANSLPLNSVPQLD
NSLTEHSMDNDIKMHVAPLEVQFRTNVHPGRHHKNRSKGHRASRLTVLEYAYDVPTSVEG
SVQNGLPKVGPGNSEGHPRSRRAYLAYRERQYNPPQQDSSDACSTLPKSSRNFEKPASTS
SKKDAFRKPAVVELESQQKSYGLNLAIQNGPIKSNGQDGSLLSTDSTGNVRTGLWKHETT
V
Download sequence
Identical sequences ENSPCAP00000015398 ENSPCAP00000015398

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]