SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000015401 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000015401
Domain Number 1 Region: 137-288,444-461
Classification Level Classification E-value
Superfamily L domain-like 9.07e-25
Family Ngr ectodomain-like 0.058
Further Details:      
 
Domain Number 2 Region: 645-702
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000000000046
Family Calponin-homology domain, CH-domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000015401   Gene: ENSPCAG00000016426   Transcript: ENSPCAT00000016453
Sequence length 707
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_6798:4691:67136:1 gene:ENSPCAG00000016426 transcript:ENSPCAT00000016453 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAGLVAVAAAAEYPGQGASGGNFSGVNCGPNSAAGPGPGPGSWSRSLDRALEEAAVTG
VLSLSGRKLREFPRGAANHDLTDTTRAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXRNQLSTLPVHLCSLPLKVLIASNNKLVSLPEEIGHLRYLTELDV
SCNEIQTIPSQIGNLEALRDLNVRRNHLVCLPEELAELPLIRLDFSCNKITAIPVCYRNL
RHLQVITLDNNPLQSPPAQICIKGKIHIFKYLNIQACKIAPDLPDYDRRPLGFGSCHEEL
YSGRPYGALDSGFNSVDSGDKRWSGNEPTDEFSDLPLRVAEMTKEQRLRRESQYQESRGS
VVVTNGGVEHDLDQIDYIDSCAAEEEEDEGRQLRGLDSLSPQFTAYIEHRRISHEGSPVK
LVPIRECQKAEDMRRTHQSKVPVDPSSLLSLSPSHNQLSHTDLEVHRKREQLVERTRREA
QRAALQYEEEKLRTKQMQRDAVLDFVKQKTAQSPQKQALLDGECPFPSRRSQHTDDSGLL
VSLSGVNQVGCAAALPPPSAFPALKSDGRSDASSGSPVTDTVHHSPAHSFPAAAVQRNLP
PRPESFLFRSTIRAEINKGHGSPLLSSSAPATDSTDATTRQNSRQREEELELIDQLRKHI
EYRLKVSLPCDLGAALTDGVVLCHLANHVRPRSVPSIHVPSPAVVSS
Download sequence
Identical sequences ENSPCAP00000015401 ENSPCAP00000015401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]