SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000015523 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000015523
Domain Number 1 Region: 40-79,214-287
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.51e-17
Family Spermadhesin, CUB domain 0.0044
Further Details:      
 
Domain Number 2 Region: 291-327
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000445
Family LDL receptor-like module 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000015523   Gene: ENSPCAG00000016603   Transcript: ENSPCAT00000016583
Sequence length 513
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_5494:17377:81695:-1 gene:ENSPCAG00000016603 transcript:ENSPCAT00000016583 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIHGRAVLHIVASLIILHLSGATKKGTEKQATSETQKSVQCGTWTKHADGGVFTSPNYPS
KYPPDRECIYIIEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIYLRFLDYEMQNSNECKRNFVAVYDGS
SSVEDLKAKFCSTVANDVMLRTGLAVIRMWADEGSRNSRFQMLFTSFQEPPCEGNTFFCH
SNMCINNTLVCNGLQNCVYPWDENHCKDKRKANLLDQLTNTSGTVIGVTSCVVIILIIIS
VIVQIKQPRKKYVQRKSDLDQTVFQEVFEPPHYELCTLRGTGAAADFADVVDDFENYHKL
RRSSSKCIHDHHCGSQLSSTKGSRSNLSTRDASVLTEMPPQPVKPLIPPMNRRNILVMKH
NYSQDAADACDIDEIEEVPTTSHRLSRHDKAVQ
Download sequence
Identical sequences ENSPCAP00000015523 ENSPCAP00000015523

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]