SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000015535 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000015535
Domain Number 1 Region: 9-253
Classification Level Classification E-value
Superfamily L domain-like 1.25e-40
Family Ngr ectodomain-like 0.031
Further Details:      
 
Domain Number 2 Region: 248-347
Classification Level Classification E-value
Superfamily Immunoglobulin 3.37e-19
Family I set domains 0.026
Further Details:      
 
Domain Number 3 Region: 378-453
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000249
Family Fibronectin type III 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000015535   Gene: ENSPCAG00000016636   Transcript: ENSPCAT00000016596
Sequence length 718
Comment pep:known_by_projection scaffold:proCap1:scaffold_54087:5273:11830:1 gene:ENSPCAG00000016636 transcript:ENSPCAT00000016596 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLCAKTLLFVPPAIDRRVVELRLTDNFIAAVRRRDFANMTSLVHLTLSRNTIGQVAAGAF
ADLRALRALHLDSNRLAEVRGDQLRGLGNLRHLILGNNQIRRVESAAFDAFLSTVEDLDL
SYNNLEALPWEAVGQMVNLNTLTLDHNLIDHIAEGTFVQLHKLVRLDMTSNRLHKLPPDG
LFLRSQGTGPKPPTPLTVSFGGNPLHCNCELLWLRRLTREDDLETCATPEHLTDRYFWSI
PEEEFLCEPPLITRQAGGRALVVEGQAVSLRCRAVGDPEPVVHWVAPDGRLLGNSSRTRV
RWDGTLDVTITTLRDSGTFTCIASNAAGEATAPVEVCVVPLPLMAPPPAAPPPLTEPGSS
DIATPGRPGANDSAAERRLVAAELTSNSVLIRWPAQRPVPGIRMYQVQYNSSADDSLVYR
MIPSTSQTFLVNDLAAGRAYDLCVLAVYDDGATALPATRVVGCVQFTTAGDPAPCRPLRA
HFLGGTMIIAIGGVIVASVLVFIVLLMIRYKVYGDGDGRRAKGTSRSPPRVSHVCSQTNG
AGAAQALPPPAQDRYEALREVTSPAAAVAVEAKAMAVEAASAESEVILGRSLGGSATSLC
LLPSEETSGDEPRAAAGPRRSRSGALGPPASAPPTLALVPGGTRPRPQQRYSFDGDYGAL
FQSHSYPRRARRTKRHRSTPHLDGAGAGAAEDDGDLRGGSARARLAFTSTEWMLESTV
Download sequence
Identical sequences ENSPCAP00000015535 ENSPCAP00000015535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]