SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000015554 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000015554
Domain Number 1 Region: 368-552
Classification Level Classification E-value
Superfamily NTF2-like 1.53e-65
Family NTF2-like 0.0000000214
Further Details:      
 
Domain Number 2 Region: 107-198
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 9.48e-36
Family Non-canonical RBD domain 0.00000646
Further Details:      
 
Domain Number 3 Region: 202-357
Classification Level Classification E-value
Superfamily L domain-like 7.65e-33
Family mRNA export factor tap 0.000000232
Further Details:      
 
Domain Number 4 Region: 549-617
Classification Level Classification E-value
Superfamily UBA-like 3.83e-26
Family TAP-C domain-like 0.000047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000015554   Gene: ENSPCAG00000016580   Transcript: ENSPCAT00000016616
Sequence length 617
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_5633:36287:49196:-1 gene:ENSPCAG00000016580 transcript:ENSPCAT00000016616 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADEGKSYNEHDDRVSLPRRKKGRGPFRWNYGEGNRRSGRGGSGARSSRLGEDDGDVAMT
DAQDGPRVRYTPYASRPSRRGDNWHDRGRIHVTVRRDRAPAERVGAGTSHDGTSKNWFKI
TIPYGRKYDKAWLLSLIQSKCSVPFTPIEFHYENTRAQFFVEDASTASALKAVNYKIVDR
ENRRISVIINPSAPPQTVQNELKPEQVEQLKLTMSKRYDGSQQALDLKGLRTDPDLVAQN
IDVVLNRRSCMAASLRIIEENIPELLSLNLSNNKLYQLDDMSSIVQKAPNLKILNLCENE
LKSERELDKIKGLKLEELWLEGNPLCDTFRDQSTYISAIRERFPKLLRLDGHELPPPIAF
DVEPPTALPPCKGSYFGSETLKSLVLHFLQQYYAIYDSEDRQRLLDAYHDGACCSLSIPV
TPQNPNRSSLAEYFKDSRNVKKLKDPSLRFRLLKHTRLNVVAFLNELPKTQHDVNSFVVD
ISAQTNTLLCFSVSGVFKEVDGKSRDSLRAFTRTFIAVPASNSGLCIVNDELFVRNASPD
EIQRAFAMPAPTPSSSPVPTLSPEQQEMLQAFSSQSGMNLEWSQKCLQDNNWDYTVSAQI
FTQLKAEGKIPEVAFMK
Download sequence
Identical sequences ENSPCAP00000015554 ENSPCAP00000015554

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]