SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000015555 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000015555
Domain Number 1 Region: 294-459
Classification Level Classification E-value
Superfamily L domain-like 1.59e-51
Family L domain 0.0000000617
Further Details:      
 
Domain Number 2 Region: 3-156
Classification Level Classification E-value
Superfamily L domain-like 7.94e-42
Family L domain 0.00000012
Further Details:      
 
Domain Number 3 Region: 456-575
Classification Level Classification E-value
Superfamily Fibronectin type III 7.38e-31
Family Fibronectin type III 0.000013
Further Details:      
 
Domain Number 4 Region: 1100-1235
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.82e-30
Family Protein kinases, catalytic subunit 0.000000506
Further Details:      
 
Domain Number 5 Region: 915-1042
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.88e-23
Family Protein kinases, catalytic subunit 0.00000211
Further Details:      
 
Domain Number 6 Region: 137-296
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.12e-16
Family Growth factor receptor domain 0.0000000841
Further Details:      
 
Domain Number 7 Region: 729-817
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000441
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 8 Region: 572-635,722-755
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000128
Family Fibronectin type III 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000015555   Gene: ENSPCAG00000016571   Transcript: ENSPCAT00000016617
Sequence length 1313
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_3698:124467:331474:1 gene:ENSPCAG00000016571 transcript:ENSPCAT00000016617 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CGPGIDIRNDYQQLRRLENCTVIEGYLHILLISKAEDYRSYRFPKLTVITEYLLLFRVAG
LESLGDLFPNLTVIRGWKLFYNYALVIFEMTNLKDIGLYNLRNITRGAIRIEKNADLCYL
STVDWSLILDAVSNNYIVGNKPPKECGDLCPGTMEEKPLCEKTSINNEYNYRCWTTSRCQ
KMCPSACGKRACSDHNECCHPECLGSCSAPDNATACVACRHYYHAGICVPTCPPNTYKFE
GWRCVDRDFCANIPSAESSDAEGFVIHDGECMQECPSGFIRNGTQSMYCIPCEGPCPKVC
EEEKKTKTIDSVTSAQMLQGCTIFKGNLLINIRRGNNIASELENFMGLIEVVTGYVKIRH
SHALVSLSFLKNLRQILGEEQLEGNYSFYVLDNQNLQQLWDWDHRNLTIKAGKMYFAFNP
KLCVSEIYRMEEVTGTKGRQSKGDINTRNNGERASCESDVLHFTSTTTRKNQIIITWHRY
RPPDYRDLISFTVYYKEAPFKNVTEYDGQDACGSNSWNMVDVDLPPNKDVEPGILLHGLK
PWTQYAVYVKAVTLTMVENDHIRGAKSEILYIRTNASVPSIPLDVLSASNSSSQLIVKWN
PPSLPNQPEYYYKIPIRKYADGTIDVEEVTENPKTEVCGGEKGPCCACPKTEAEKQAEKE
EAEYRKVFENFLHNSIFVPRPERKRRDVMQVANTTMSSRSKNATVADGYNITDPEELETE
FPFYESRVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDI
PGPVTWESRPENSIFLKWPEPQNPNGLILMYEIKYGIQVEDQRECSRQXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRPYENFIHLIISVPVAALLIVGGLVIM
LYVFHRKRSSSRLGNGVLYASVNPEYFSAADVYVPDEWEVAREKITMSRELGQGSFGMVY
EGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQP
TLVIMELMTRGDLKSDLRSLKTETEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTHSD
VWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRLCWQYNPR
MRPSFLEIISSIKDEMEPGFREVSFYYSEENKPPEAEELDLEPENMESVPLDPSASASSL
PLPERHSGHKAENGPGPGVVVLRASFDERQPYAHMNGGRKNERALPLPQSSTC
Download sequence
Identical sequences ENSPCAP00000015555 ENSPCAP00000015555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]