SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000015741 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000015741
Domain Number 1 Region: 4164-4366
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.9e-37
Family Laminin G-like module 0.00061
Further Details:      
 
Domain Number 2 Region: 3677-3848
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.17e-30
Family Laminin G-like module 0.0014
Further Details:      
 
Domain Number 3 Region: 1954-2043
Classification Level Classification E-value
Superfamily Immunoglobulin 1.69e-19
Family I set domains 0.017
Further Details:      
 
Domain Number 4 Region: 3215-3308
Classification Level Classification E-value
Superfamily Immunoglobulin 2.85e-19
Family I set domains 0.0092
Further Details:      
 
Domain Number 5 Region: 3500-3610
Classification Level Classification E-value
Superfamily Immunoglobulin 5.37e-19
Family I set domains 0.014
Further Details:      
 
Domain Number 6 Region: 3302-3388
Classification Level Classification E-value
Superfamily Immunoglobulin 8.57e-19
Family I set domains 0.012
Further Details:      
 
Domain Number 7 Region: 2636-2724
Classification Level Classification E-value
Superfamily Immunoglobulin 3.63e-18
Family I set domains 0.02
Further Details:      
 
Domain Number 8 Region: 3119-3206
Classification Level Classification E-value
Superfamily Immunoglobulin 5.31e-17
Family I set domains 0.043
Further Details:      
 
Domain Number 9 Region: 2442-2530
Classification Level Classification E-value
Superfamily Immunoglobulin 1.2e-16
Family I set domains 0.054
Further Details:      
 
Domain Number 10 Region: 1674-1762
Classification Level Classification E-value
Superfamily Immunoglobulin 1.24e-16
Family I set domains 0.021
Further Details:      
 
Domain Number 11 Region: 2544-2626
Classification Level Classification E-value
Superfamily Immunoglobulin 8.67e-16
Family I set domains 0.012
Further Details:      
 
Domain Number 12 Region: 3029-3124
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000021
Family I set domains 0.019
Further Details:      
 
Domain Number 13 Region: 2737-2823
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000306
Family I set domains 0.072
Further Details:      
 
Domain Number 14 Region: 2050-2141
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000477
Family I set domains 0.041
Further Details:      
 
Domain Number 15 Region: 2833-2919
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000848
Family I set domains 0.037
Further Details:      
 
Domain Number 16 Region: 2931-3017
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000115
Family I set domains 0.086
Further Details:      
 
Domain Number 17 Region: 2157-2238
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000153
Family V set domains (antibody variable domain-like) 0.092
Further Details:      
 
Domain Number 18 Region: 1864-1951
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000169
Family I set domains 0.032
Further Details:      
 
Domain Number 19 Region: 3408-3497
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000205
Family I set domains 0.018
Further Details:      
 
Domain Number 20 Region: 2251-2327
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000102
Family I set domains 0.054
Further Details:      
 
Domain Number 21 Region: 2351-2433
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000348
Family I set domains 0.075
Further Details:      
 
Domain Number 22 Region: 4024-4103
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000158
Family Laminin G-like module 0.0089
Further Details:      
 
Domain Number 23 Region: 282-318
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000694
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 24 Region: 763-815
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000148
Family Laminin-type module 0.0052
Further Details:      
 
Domain Number 25 Region: 1158-1210
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000502
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 26 Region: 823-871
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000743
Family Laminin-type module 0.02
Further Details:      
 
Domain Number 27 Region: 1562-1614
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000229
Family Laminin-type module 0.0066
Further Details:      
 
Domain Number 28 Region: 3842-3883
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000251
Family EGF-type module 0.014
Further Details:      
 
Domain Number 29 Region: 196-236
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000367
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 30 Region: 4106-4150
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000349
Family EGF-type module 0.01
Further Details:      
 
Domain Number 31 Region: 1621-1669
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000142
Family Laminin-type module 0.065
Further Details:      
 
Weak hits

Sequence:  ENSPCAP00000015741
Domain Number - Region: 1218-1263
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000106
Family Laminin-type module 0.028
Further Details:      
 
Domain Number - Region: 1274-1321
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000201
Family Laminin-type module 0.0051
Further Details:      
 
Domain Number - Region: 886-925
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000368
Family Laminin-type module 0.022
Further Details:      
 
Domain Number - Region: 3888-3925
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00192
Family EGF-type module 0.032
Further Details:      
 
Domain Number - Region: 1121-1160
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00242
Family Laminin-type module 0.084
Further Details:      
 
Domain Number - Region: 723-765
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0146
Family EGF-type module 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000015741   Gene: ENSPCAG00000016472   Transcript: ENSPCAT00000016822
Sequence length 4392
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_6930:28540:153135:-1 gene:ENSPCAG00000016472 transcript:ENSPCAT00000016822 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRRAASAPLLALLLLLHGQLLVVTHGLRAYDGLSMPEDAETVTVGRAGWSYSDLSDDED
LLADSASGDDIGSGDVGSGDFQMVYFRALVNFTHSIDYSPQLEDAGSEEFREVSEAVVDT
LESEYLKIPGDQVVSVVFIKELNGWAFVELDVGSEGNADMAQIQDVLHSVISSGSIASYI
TSPQGFQFRRLGTVPQPSRACTEAEFACHSHNECVALEYRCDRRPDCRDMSDELNCEELI
PSSPTHVVETPPPSPQLEATILPMPPATPTPWPVFTDQGKPAPCGSHEATCHSGHCIPKD
YLCDGQEDCKDGSDELDCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXPCPDGHFYLEDSASCLPCFCFGVTNVCQSSRRFWDQIR
LRFDQPNNFKGVNVTMPAQPGMPPLSSTQLQIDVTLQEFQLVDLSRRFLVHDSFWALPQQ
FLGNKVDSYGGSLRYKVRYELARGTLEPVQRPDVVLVGAGYRLLSRGHTHTQPGTVNQRQ
VQFSEEHWVHESGRPVQRAEMLQVLQSLEAVLIQTVYNAKMASVGLSDIVMDTTVTHTTS
HGRAHSVEECRCPIGYSGLSCESCDAHFTRMPGGPYLGTCSGCNCNGHASSCDPVYGHCL
NCQHNTEGPQCNKCKAGFFGDATKATATACRPCPCPYIDASRRFSDTCFLDTDGQATCDA
CAPGYTGRRCESCAPGYEGNPIQPGGKCRPVNQQIVRCDERGSMGTSGEACRCKNNVVGR
LCNECASGSFNLNARNPDGCLKCFCMGVSRQCTSSSWSRAQVHGASEEPTQFSLTNAAGT
YVTSVDISSPTPGELVFSSFHSLLSGPYFWNLPPRFRGDKVTSYGGELRFTVTQQPQPGS
LPLPRQPLVVLQGNGIVLEHHVTQEPSPGQPSTFTVPFREQAWQRPDGQPATREHLLMAL
AGIDTLLIQASYTQRPAESRISGISMDIAVPEDTGQDPALEVEQCTCPPGYRGPSCQDCD
RGYTRTPSGLYLGTCERCSCHGHTEICEPETGACQGCQHHTEGPQCEQCQPGYYGDAQRG
TPQDCQPCPCHGAPAAGQATHTCFLDTDGHPTCDACSPGHSGRNCERCATGYSGNPSQGQ
PCQRDGQLPQPIGCDCDPQGSVSSQCNAAGQCQCKAQVEGLTCSQCRPHHFHLSASNPDG
CLPCFCMGITQQCASSPYTRRLISTHFAPGDFQGFALMNPQRNSRLTGGFTVEPVPYGTQ
LSFSNFTQLGHESFYWQLPETFQGDKVTAYGGKLRYTLSYTAGAQGSPLSDPDVQITGNN
IMLVASQPALQGSERKSYEIVFREEFWRRPDGQPATREHLLMALADLDELLVRATFSSVP
LAASISAVSLEVAQPGPSDGPPALEVEECRCPPXXXXXXXXDCAPGYTRTGSGLYLGHCE
LCECNGHSDLCHPETGACSQCQHNAAGEFCEKCVMGYYGDATAGTPEDCQPCACPLTNPE
NMFSRTCESLGAGGYRCTACEPGYTGQYCEQCAPGYVGNPNVRGGRCVPQADQAPLVVQV
HPARSVVPQGGPHSLRCQVTGNPPHYFYWSREDGRPVPSSTQQRHQGSELYFPSVQPSDA
GIYICTCRNHHHANSSRAELLVAEALSKLITVTVXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDQGTATLHVQASG
APSTPVVSIHPPQLTVQPGQLAEFRCSATGSPTPTLEWAGGPGGQLPQKAQIHGGILRLP
AVEPSDQAQYLCRAHSSAGQQVARAVLHVYGGSGPRVQVSPERTQVHEGRTVRLYCRAAG
VPSATITWRKEGGSLPPQARSERTDIATLLIPAITTADAGFYLCVATSPAGTAQARIQVV
VLPALGGSTPPVRIESSSPSVTEGQMLDLNCVVAGQGHAQVTWYRRGSTLPPHAQVHGSR
LRLPQVSPADSGEYVCRVENIENESGPKEASITVSVLHSARPGPSYTPAPGGAQPIRIES
SSSHVAEGQTLDLNCVVPGQAHAQVTWYKRGGSLPARHQAHGSLLRLYQVSPADSGEYVC
RVVLGSGPLETSVLVTIEASDSSAGSIPGPVAPVRIESSSPTVAEGQTLDLSCVVAGQAH
APVTWFKRGGSLPARHQVRGSRLYIFQASPADAGEYVCRASNGMEASIIVTVTRTQETNF
TSPSGGLQPIRIESSSSHVAEGQTLDLNCMVPGQAHAQVTWQKRGGSLPIRHQTHGSLLR
LYQVSPADSGEYVCRVVGSSVPQEASVLVTIEPADSVPRLSVTPPVRIESSSSHVAEGQT
LDLNCLVSGQAHAQVTWHKRGGSLPARHQIFGSRLRLPHVTPADSGEYVCRVVSNSGTQE
TSVLVTIQQRLGPSRSPGVVYPVRIESSSASLANGHTLDLNCLVASQAPHTITWYKRGGS
LPSRHQIVGSRLRIPQVTPADSGEYVCHVSNGAGSQETSLIVTIQGSSFSHVPSVSPPMR
IESSSPTVVEGQTLDLNCVVAGQPQATITWYKRGGSLPAQHQTHGSRLRLRHMSVADSGE
YVCRANNNIDAQEASIVVSVSPSTSMPSXXGGTQPIRIESSSSHVAEGQTLDLNCVVPGQ
AHAQVMWYKRGGSLPTHHQLHGSRLRLYQVSPADSGEYVCRVVGSSGPLEASVLVTIEAS
GSSSVHVPAPGGAPPIHIETSSSRVAEGQTLDLNCIVPGQAHAQITWHKRGGRLPSRHQV
HGPMLRLNQVSPADSGEYSCEVTSSSGTLEASVLVTIEAASPGPIPAPGLAQPIYIEASS
SHVTEGQTLDLNCVVPGQAHAQVTWHKHGGSLPAQHQTHGSRLRLYHVSPTDSGKYVCRV
VGGPGPEQEASFTVTVLPNASYVSRLSVPVISIDPPGSTVQQGQDASFKCLIHEGAAPVS
FEWKTQSQELEDNVHISPNGSIITIVSTRPSNRGAYRCVASNAYGVAQRVVNLSVHGPPS
VSVLPEGPVRVKVGKSITLECVSSGEPRSSAHWTRIPPKLEQRTHGHVDSHTVLQISSAK
PSDAGIYVCLAQNALGTAQKQVEVIVDMGATAPGAPQVQVEEVELTVEAGHTATLRCSAT
GSPTPTIHWSKLRSPLPWQHRLEGNTLIIPRVAQQDSGQYICNATSPAGHAEATIALHVE
SPPYATTVPEHASVRAGETVQLQCLAHGTPPLTFQWSRVGGSLPESAVTRNEVLRFEPTA
PEDSGRYRCQVTNRVGLAEAFAQLTVQGSVPAGFPPGTSDSAGSLHTVQVTPQLETRSIG
SSVEFHCAVPNDRDTQLRWFKEGGQLPPGHSVQDGVLRIQNLDQSCQGTYVCQAHGPWGQ
AQASAQLVVQALPSVLINIRTSVQTVVVGHAVEFECLALGDPKPQVTWSKVGGRLRPGIV
QSGGVIRIAHVELADAGQYRCTATNAAGTTQSHVLLLVQALPQISTPPEVRVPAGSAAVF
PCMASGYPTPDITWSKLDGNLPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXRVVPYFTQPYLPLTIKDYRKFEIKITFRPDSADGMLLYNGQKRTPGSPTSPAHR
QPDFISFGLVGGRPEFRFDAGSGMATIRHPTPLALGQFHTVTLLRSLTQGSLVVGNLAPI
NGTSQGKFQGLAPNEELYLGGYPDYGAIPKAGLDSGFIGCVRELRIQGEEIVFHDLNLTA
HGISHCPTCRDRPCQNGGRCHDSESSSYVCLCPAGFTGSRCEHSQALHCHPEACGPDATC
VNRPDGRGYTCRCHLGRSGTKCEEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXKDGSLQVNGGRPVLRSSPGKSQGLNLNTLLYLGGVEPSVQLPLATNVSTHFHGCVGE
VSVNGKRLDLTYSFLGSQGVGQCYDSSPCERQPCQNGATCMPAGEYEFQCLCQDGFKGDL
CEHDENPCQLHESCLHGGTCKGARCLCAPGFSGPRCQHGSGHGTAESDWHLESSGGNDAP
GQYGAYFHDGGFLALPGRSFSRGPPEAPETIELEVRTSTANGLLLWQGVVVGETSQGKDF
ISLGLQDGQLVFSYQLGSGEARLVSEDPINDGEWHRVTAQREGRRGSIQVDGEEMVTGQS
PGPNVAVNTKGSIYVGGAPDVATLTGGRFSAGITGCIKSLVLHSAWPGAPPLQPLDLRHR
AQAGANTRPCPS
Download sequence
Identical sequences ENSPCAP00000015741 ENSPCAP00000015741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]