SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000015788 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000015788
Domain Number 1 Region: 18-75
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.55e-22
Family HkH motif-containing C2H2 finger 0.0000797
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000015788   Gene: ENSPCAG00000016885   Transcript: ENSPCAT00000016871
Sequence length 175
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_2692:2934:21885:1 gene:ENSPCAG00000016885 transcript:ENSPCAT00000016871 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSSVSVVPLLAGFHFLFSRFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQKWMEE
QAQSLIDKTTAAFQQGKIPPTPFSAPPPAGAMIPPPPSLPGPPRPGMMPAPHMGGPPMMP
MMGPPPPGMMPVGPAPGMRPPMGGHMPMMPGPPMMRPPARPMMVPTRPGMTRPDR
Download sequence
Identical sequences ENSPCAP00000015788 ENSPCAP00000015788

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]