SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000015842 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000015842
Domain Number 1 Region: 715-1007
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.07e-80
Family Protein kinases, catalytic subunit 0.000000000465
Further Details:      
 
Domain Number 2 Region: 78-207
Classification Level Classification E-value
Superfamily L domain-like 5.1e-35
Family L domain 0.0000765
Further Details:      
 
Domain Number 3 Region: 431-516
Classification Level Classification E-value
Superfamily L domain-like 2.16e-18
Family L domain 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000015842   Gene: ENSPCAG00000016918   Transcript: ENSPCAT00000016929
Sequence length 1308
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_6359:15760:394442:-1 gene:ENSPCAG00000016918 transcript:ENSPCAT00000016929 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLATGLWVWVSLLVAAGTVQPSASQSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXSIREVTGYVLVALNQFRYLPLENLRIIRGTKLYEDRYALAIF
LNYRKDGNFGLQELGLKNLTEILNGGVYVDQNKFLCYADTIHWQDIVRNPWPSNLSLVST
NGSSGCGRCHKSCTGRCWGPTENHCQTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNFVVD
SSSCVRACPSSKMEVEENGIKMCKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXGLSLLILKQQGITSLQFQSLKEISAGNIYITDNNNLCYYHTINWTTLFST
INQRIVIRDNRKAENCTAEGMVCNHLCSSDGCWGPGPDQCLSCRRFSRGKTCIESCNLYD
GXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXCSGPTSHDCIYYPWTGHSTLPQHARTPLIAAGVIGG
LFILVIMGLTFAVYARRKSIKKKRALRRFLETELVEPLTPSGTAPNQAQLRILKETELKR
VKVLGSGAFGTVYKGIWVPEGETVKIPVAIKILNETTGPKANVEFMDEALIMASMDHPHL
VRLLGVCLSPTIQLVTQLMPHGCLLDYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLV
HRDLAARNVLVKSPNHVKITDYGLARLLEGDEKEYNADGGKMPIKWMALECIHYRKFTHQ
SDVWSYGVTIWELMTFGGKPYDGIPTREIPDLLEKGERLPQPPICTIDVYMVMVKCWMID
ADSRPKFKELAAEFSRMARDPQRYLVIQGDDRMKLPSPNDSKFFQNLLDEEDLEDMMDAE
EYLVPQAFNIPPPIYTSRARIDSNRSEIGHSPPPAYTPMSGNQFVYRDGGFAPEQGVSVP
YRATTSTIPEAPVTQGATAEIFDDSCCNGTLRKAVAPHIQEDSSTQRYSADPTVFAPERS
PRGELDEEGYMTPMRDKPKQEYLNPVEENPFVSRRKNGDLQALDSSEYHSASSGPREAEE
EYVNEPLYLNTFASALGNAQYLKNNILSVPEKAKKAFDNPDYWNHSLPPRSTLQHPDYLQ
EYSTKYFYKQNGRVRPIVAENPEYLSEFSLKPGTVLPPPPYRHRNTVV
Download sequence
Identical sequences ENSPCAP00000015842 ENSPCAP00000015842

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]