SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000000010 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000000010
Domain Number 1 Region: 464-521
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.13e-25
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 2 Region: 57-118
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.75e-25
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 3 Region: 520-577
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.67e-24
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 4 Region: 688-745
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.46e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 5 Region: 408-465
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.55e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 6 Region: 576-631
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.81e-22
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 7 Region: 634-689
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.2e-22
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 8 Region: 730-782
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.24e-17
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 9 Region: 297-354
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000115
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 10 Region: 356-409
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000013
Family Classic zinc finger, C2H2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000000010   Gene: ENSPCAG00000000009   Transcript: ENSPCAT00000000011
Sequence length 792
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_5535:9773:27899:-1 gene:ENSPCAG00000000009 transcript:ENSPCAT00000000011 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAINPWASWXXXXXXXXXXXXXXXXXXXXLYPRDPAWPVEGTPEEERRTARLPTDQIQE
PVTFKDIAVDFSQEEWGQLDPVQRTLYRDVMLETFGHLISVGNEINKPEVISLLEQGEEP
WTVERRCPQSAWSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDPWFSRVEVLGCE
HSLEMYHMNQSTAMRQMVFMQKQVLSQRGSDFCELESDCSQSLNIVPSQRLSQAEHFYKP
DTHAESWRYNSAIMYADKFTCENNDYGKALYQSIQPIHPLGMQTGDNLFKYTDAVKSFNQ
IIHFGDHKRIHTGEKLYEYKECHQIFNESPSFNEHPRFHIGENQYDYKEYENIFYFSSIM
EHQKIDTVEKAYKYNEWEKVFGYDSFLTQHTSTYTAEKPYEYNECGTSFIWSSYLIQHKK
THTGEKPYECDKCGKVFRNRSALTKHERTHTGIKPYECNKCGKAFSWNSHLIVHKRIHTG
EKPYVCNECGKSFNWNSHLVGHQRTHTGEKPFECTECGKSFSWSSHLIAHMRMHTGEKPF
KCDECEKAFRDYSALSKHERTHSGAKPYKCTECGKSFSWSSHLIAHQRTHTGEKPYNCQE
CGKAFRERSALTKHEIIHSGIKPYECNKCGKCCSQMAHLVRHQRTHTGEKPYECNKCGKS
FSQSCHLVAHRRIHTGEKPYKCNQCERSFNCSSHLIAHRRTHTGEKPYRCNECGKAFNES
SSLIVHLRNHTGEKPYKCNHCEKAFCKNSSLIIHQRMHNGDRRFICNECGKAFSGHSALI
QHQRNHSEEKLN
Download sequence
Identical sequences ENSPCAP00000000010 ENSPCAP00000000010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]