SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000001416 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000001416
Domain Number 1 Region: 67-173
Classification Level Classification E-value
Superfamily POZ domain 6.48e-22
Family BTB/POZ domain 0.0028
Further Details:      
 
Domain Number 2 Region: 561-613
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.86e-17
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 3 Region: 598-650
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000681
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 4 Region: 360-412
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000011
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 5 Region: 693-743
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000312
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 6 Region: 518-570
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000093
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 7 Region: 464-511
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000221
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Weak hits

Sequence:  ENSPCAP00000001416
Domain Number - Region: 206-232
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00683
Family Classic zinc finger, C2H2 0.049
Further Details:      
 
Domain Number - Region: 421-447
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0069
Family Classic zinc finger, C2H2 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000001416   Gene: ENSPCAG00000001516   Transcript: ENSPCAT00000001505
Sequence length 838
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_6329:12089:57063:-1 gene:ENSPCAG00000001516 transcript:ENSPCAT00000001505 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKRRKVTSNLDQKIHLGYHKDSLEGHGAVECDQVTYTPTERPTPETLHCYQDFPPSPDQ
RKLLSSLQYNKNLLKYLNDDRQKQPSFCDLLIIVEGKEFSAHKVVVAVGSSYFHACLSKN
PSTDVVTLDHVTHSVFQHLLEFLYTSEFFVYKYEIPLVLEAAKFLDIIDAVKLLNNENVA
SFQSELTETSSPEETLNELTGRLSNNHQCKFCSRHFCYKKSLENHLSKTHRSLLLGKKHG
LKMLERSFSARRSKRNLKGKCPVKFDDTSDDEQESGDGSDTVNQENFGKVKLDRNDSEDP
GSEYNAEEDCLEEEMSDEYSDIEEQSEKGQDDTEEKPEAGDSVSIHEGLTPVVIQNSNKK
ILQCPKCDKTFDRIGKYESHTRVHTGEKPFECDICHQRYSTKSNLTVHRKKHNNETEFHK
KEHKCPYCNKLHASKKTLAKHVKRFHLENAQEFISIKKTKSESWKCDICKKSFTRRPHLE
EHMILHSQDKPFKCTYCEEHFKSRFARLKHQEKFHLGPFPCDICGRQFNDTGNLKRHIEC
THGGKRKWTCFICGKSVRERTTLKEHLRIHSGEKPHLCSICGQSFRHGSSYRLHLRVHHD
DKRYECDECGKTFIRHDHLTKHKKIHSGEKAHQCEECGKCFGRRDHLTVHYKSVHLGEKV
WQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEKPYKCQICNQSFRIKKTLTKHLVIHS
DARPFNCQHCDATFKRKDKLKYHIDHVHGIKSLDDPLSTSEEKLVSLPVEYSSDDKIFQA
ETKHYMDQTKVYQSEAKAMLQNVSAEVCVPVTLVPVQMPDPHNELVRHPATLPSSHEI
Download sequence
Identical sequences ENSPCAP00000001416 ENSPCAP00000001416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]