SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000001464 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000001464
Domain Number 1 Region: 169-364
Classification Level Classification E-value
Superfamily E set domains 4.67e-76
Family Cytoplasmic domain of inward rectifier potassium channel 0.000000463
Further Details:      
 
Domain Number 2 Region: 60-185
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.12e-23
Family Voltage-gated potassium channels 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000001464   Gene: ENSPCAG00000001602   Transcript: ENSPCAT00000001555
Sequence length 414
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_4792:10731:40689:-1 gene:ENSPCAG00000001602 transcript:ENSPCAT00000001555 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NVLEGDSMDQDVESPVAIHQPKLPKQARDDLPRHISRDRTKRKIQRYVRKDGKCNVHHGN
VRETYRYLTDIFTTLVDLKWRFNLLIFVMVYTVTWLFFGMIWWLIAYIRGDMDHIEDPSW
TPCVTNLNGFVSAFLFSIETETTIGYGYRVITDKCPEGIILLLIQSVLGSIVNAFMVGCM
FVKISQPKKRAETLVFSTHAVISMRDGKLCLMFRVGDLRNSHIVEASIRAKLIKSKQTSE
GEFIPLNQTDINVGYYTGDDRLFLVSPLIISHEINQQSPFWEISKAQLPKEELEIVVILE
GMVEATGMTCQARSSYITSEILWGYRFTPVLTLEDGFYEVDYNSFHETYETSTPSLSAKE
LAELASRAELPLSWSVSSKLNQHAELETEEEEKNPEEQTERNGDVANLENESKV
Download sequence
Identical sequences ENSTTRP00000005008 ENSPCAP00000001464 ENSTTRP00000005008 ENSPCAP00000001464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]