SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000002579 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000002579
Domain Number 1 Region: 735-862
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000439
Family Growth factor receptor domain 0.0086
Further Details:      
 
Domain Number 2 Region: 383-425
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000949
Family EGF-type module 0.0062
Further Details:      
 
Domain Number 3 Region: 633-675
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000209
Family EGF-type module 0.0076
Further Details:      
 
Domain Number 4 Region: 408-533
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000651
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 5 Region: 347-387
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000328
Family EGF-type module 0.013
Further Details:      
 
Domain Number 6 Region: 668-708
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000456
Family EGF-type module 0.011
Further Details:      
 
Domain Number 7 Region: 305-349
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000137
Family EGF-type module 0.012
Further Details:      
 
Domain Number 8 Region: 712-746
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000783
Family EGF-type module 0.013
Further Details:      
 
Weak hits

Sequence:  ENSPCAP00000002579
Domain Number - Region: 598-637
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00795
Family EGF-type module 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000002579   Gene: ENSPCAG00000002704   Transcript: ENSPCAT00000002735
Sequence length 1237
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_6701:9218:33953:-1 gene:ENSPCAG00000002704 transcript:ENSPCAT00000002735 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRTRGRGRLPWQPRLLLLALWAQAARPMGYFELQLSALRNANGELLNGACCDGDGRTTRA
GSCGHDECDTYVRVCLKEYQAKVTPTGPCSYGHGATPVLGGNSFYLPPAGDRARARARAA
GDHNPGLVVIPFQFAWPRSFTLIVEAWDWDNDTKPDEDLLIERVSHAGMINPEDRWKSLH
FSGHVAHLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXCSYGWQGRFCDECVPYPGCVHGSCVEPWQCTCETNWGGL
LCDKDLNYCGSHQPCTNGGTCINAEPDQYHCACPDGYSGKNCERAEHACASNPCANGGSC
HEVPSGFECHCPSGWSGPTCALDIDECASSPCAAGGTCVDQVNGFECICPEQWVGTTCQL
DANECEGKPCLNAFSCKNLIGGYYCDCIPGWKGANCHININDCRGQCQHGGTCKDLVSGY
QCLCPRGFGGRHCELEHGECASGPCHGGGLCEDLVDGFHCHCPRGLSGPLCEXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIDGCGLEAGLGPGTVPS
SVCGPHGHCVSQPGGNFSCICDSGFTGTYCHENIDDCLGRPCHNGGTCIDEVDAFRCFCP
SGWEGELCDINLNDCLPDPCHSRGRCFDLVNDFYCACNDGWKGKTCHSREFQCDAYTCSN
GGTCYDSGDTFRCACPPGWKGSTCNIAENSSCLPNPCVNGGTCVGSGDSFSCICRDGWEG
RTCTHNTNDCNPLPCYNGGICVDGINWFRCECAPGFAGPDCRINIDECQSSPCAYGATCV
DEINGYRCSCPPGRSGLRCQEVIGFGRSCWSRGTPFPHGSSWVEDCNSCRCLDGHRDCSK
VWCGWKPCLLAGWPDALSAQCPPGQRCQKAPGQCLQPPCAAWGECGTEEPLPPSTPCRPH
SSHLDNNCARLTLHFDHDQVPQGTTVGTVCAGIRSLPATRAVARDRLLVLLCDRAPSGPS
AVEVAVSFSPARDPADSSTIQSAAHAIVAAITQRGNSSLLLAVTEVKVETAVVGSSSTDL
LVPVLCGVFSTLWLACVAICVWWTRKRRKERERSRLPREEGANNQWAPLNPIRNPIDRPG
AGGHKDVLYQCKNFTPHPRRASEALPGPAGHGVGEDEEDEELGCSQEDFLEAEKFLSHSC
TKDPGCTPGRPALWASGSKVDNRAVRSVNDARFASKD
Download sequence
Identical sequences ENSPCAP00000002579 ENSPCAP00000002579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]