SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000003160 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000003160
Domain Number 1 Region: 4-64
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.11e-23
Family KRAB domain (Kruppel-associated box) 0.00081
Further Details:      
 
Domain Number 2 Region: 240-297
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.5e-20
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 3 Region: 202-254
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.13e-17
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 4 Region: 286-338
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.12e-17
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 5 Region: 356-409
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.22e-16
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Weak hits

Sequence:  ENSPCAP00000003160
Domain Number - Region: 401-426
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00636
Family Classic zinc finger, C2H2 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000003160   Gene: ENSPCAG00000003398   Transcript: ENSPCAT00000003364
Sequence length 529
Comment pep:novel scaffold:proCap1:scaffold_23375:2354:7774:-1 gene:ENSPCAG00000003398 transcript:ENSPCAT00000003364 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKIQESLELDDVTVKFTWEEWQLLDSVQKDLYQDVMLENYSNLVSVGYWVSKPDALSIL
ERGEPLWSSEDEIYSQSFSGIQKINDCLLGHMPNESKLTRIEQCSENNTFENADQHYSHF
DLKQDHSMLDLHGKTVKSILTLINQYKKDEIKNSAKFTGDEEIFLHKNCEKFDTEFKYHE
SEKSNNVKSHITEYHKTDKIEKPHVCSECGKAFFWKSVLMNHRMIHTGEKPHRCSVCGEA
FSRKFMLTTHQKAHTEEKSYECTECGKVFVTKSGLNMHQKTHIGEKPCICSECGKCFNRQ
LSLTVHQRIHTGERPYICSECGKCFFRELSLIVHQRSHTRQISSAGMDCGKILLKKSWLS
IHQKTHKLEKSFQCSECGKAFYRKKQLNLHKRMHTRNRPCVCNVCGKSFDSTLERFNHKL
THTREKYVNSGKVEDPSSVSHSSAHTSDCMQGKSPVNTVSLQMPSLASQSSLNTTGFLTN
RNIVLLGQPVPGREPSGNNREFVQERNIINPVNVVVPSVINYVLFYVTE
Download sequence
Identical sequences ENSPCAP00000003160 ENSPCAP00000003160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]