SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000003549 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000003549
Domain Number 1 Region: 231-467
Classification Level Classification E-value
Superfamily Mitochondrial carrier 5.75e-71
Family Mitochondrial carrier 0.00011
Further Details:      
 
Domain Number 2 Region: 10-169
Classification Level Classification E-value
Superfamily EF-hand 5.94e-39
Family Calmodulin-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000003549   Gene: ENSPCAG00000003788   Transcript: ENSPCAT00000003780
Sequence length 477
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_908:10475:70281:-1 gene:ENSPCAG00000003788 transcript:ENSPCAT00000003780 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRWLRGFVLPMAACQDAQPPTRYETLFQQLDRNRDGVVDIGELQEGLKNLGIPLGQDAE
EKIFSTGDINKDGKLDFEEFMKYLKDHEKKMKLAFKSLDKNNDGKIEASEIVQSLQTLGI
TISEKQAELILQSIDADGTMTVDWNEWRDYFLFNPATDIEEIIRFWKHSTXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVHGSKSDKMNLVGGFQQ
MVKEGGIRSLWRGNGTNVIKIAPETAVKFWAYEQYKKLLTEEGQKVGTFERFISGSMAGA
TAQTFIYPMEVIKTRLAVGKTGQYSGIFDCAKKILKHEGLGAFYKGYVPNLLGIIPYAGI
DLAVYELLKSHWLDNFAKDTVNPGVMVLLGCGALSSTCGQLASYPLALVRTRMQAQAMLE
GKPQLNMVGLFRRIISKEGIRGLYRGITPNFMKVLPAVGISYVVYENMKQTLGVAQK
Download sequence
Identical sequences ENSPCAP00000003549 ENSPCAP00000003549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]