SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000004138 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000004138
Domain Number 1 Region: 1155-1218
Classification Level Classification E-value
Superfamily TB module/8-cys domain 7.59e-17
Family TB module/8-cys domain 0.00021
Further Details:      
 
Domain Number 2 Region: 1321-1382
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000157
Family TB module/8-cys domain 0.0015
Further Details:      
 
Domain Number 3 Region: 857-979
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000046
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 4 Region: 566-648
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000008
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 5 Region: 804-844
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000323
Family EGF-type module 0.007
Further Details:      
 
Domain Number 6 Region: 264-305
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000000405
Family TB module/8-cys domain 0.0036
Further Details:      
 
Domain Number 7 Region: 1262-1312
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000402
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 8 Region: 1223-1271
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000514
Family EGF-type module 0.011
Further Details:      
 
Domain Number 9 Region: 949-1065
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000146
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 10 Region: 1059-1096
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000199
Family EGF-type module 0.01
Further Details:      
 
Domain Number 11 Region: 1508-1548
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000156
Family EGF-type module 0.016
Further Details:      
 
Weak hits

Sequence:  ENSPCAP00000004138
Domain Number - Region: 132-161
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000197
Family EGF-type module 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000004138   Gene: ENSPCAG00000004313   Transcript: ENSPCAT00000004411
Sequence length 1548
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_4953:238827:267181:1 gene:ENSPCAG00000004313 transcript:ENSPCAT00000004411 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AATAASLASPSPRQAVEVAVITGRPAGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXLCPLICHNGGVCVKPDRCLCPPDFAGKFCQLHSAGARPPAPAMPGLTRSVY
TMPLANHRDDEHGVASMVSVHVEHPQEASVVVHQVERVSGPWAETDAEAVARAEAAARAE
AAAPYTVLGQSAPREEGYSDASGYGYCFRELRGSECASPLPGLRTQEVCCRGAGLAWGVH
DCLPCSDHLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXQGTHCDVDECRRIPTTCAPGHCENTPGSYRCVCGPGYRAGPR
GAECLDVDECHRVPPPCDRGRCENTPGSFLCVCPAGYQAVPHRASCQXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
CPGQECVNSPGSFQCRACPVGHHLHRGRCIDVDECSSGAPCGPHGHCTNTDGSFRCSCAP
GYRPPANRPGPCSDVNECLEGDFCFPNGECLNTDGSFVCTCAPGYRPGPRGASCLDVDEC
SEEDLCQSGICTNTDGSFECICPPGHRASPDLAFCLDVDECRERGPALCGSQRCENSPGS
YRCVRDCDPGYHAGPEGTCDDVDECQEYGPSICGAQRCENTPGSYRCTPACDPGYQPTPG
GGCQDVDECRNRSFCGAHATCQNLPGSFQCLCDQYEGARDGRHCVDVNECETLQGVCGAA
LCENVEGSFLCVCPTSPEEFDPMTGRCVPPQPSAGTFPGSQPQVPSSPGLPARQPQPPPP
RRPSVPRPGTVGNGRRECYFDTTAPDVCDNILGWNVTWQECCCTVGEGWGSGCRVQQCPS
TETAEYQSLCPFGRGYLAPGGDPALRRDVDECQLFQDQVCKSGVCVNTAPGYSCYCSNGY
YYHAQRLECIDNDECADEEPACEGGHCVNTVGSYHCTCEPPLVLDRSRRRCVSNESQSLE
DNLGVCWQEVGADLVCSRPRLDRQATYTECCCLYGEAWGMDCALCPAQDSDDFEALCNVL
RPPAYGPPRPGGFGLPYEYGPDLGPPYPGLPYAPELYPPPVLPYDPYPPPPGPFARREAP
YGVPPFDMPDFEDDGGPFAESEAPAPPSPGTRWRYRPRDTRGSFPEPEELPEGGRYNGAL
AGPYEGLQAEECGILDGCAHGRCVRVPEGFTCDCFDGYRLDMTRMSCV
Download sequence
Identical sequences ENSPCAP00000004138 ENSPCAP00000004138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]