SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000004250 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000004250
Domain Number 1 Region: 56-137
Classification Level Classification E-value
Superfamily Hormone receptor domain 3.53e-21
Family Hormone receptor domain 0.00052
Further Details:      
 
Domain Number 2 Region: 199-393
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000915
Family Rhodopsin-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000004250   Gene: ENSPCAG00000004527   Transcript: ENSPCAT00000004531
Sequence length 423
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_1608:752:11745:1 gene:ENSPCAG00000004527 transcript:ENSPCAT00000004531 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRWPWGAAILCLLNLSPSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPVTWD
GLLCWPKADSGEWITLPCPDFFSHFSSEPGAVKRDCTSTGWSEPFPPYPVACPVPLELLA
EEKLYFSTVKIIYTAGHSISAVTLLVAVTILVALXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXALCKVSVAASHFATMTNFSWLLVEAVYLTCLLASTSPRAKC
PFWWLVLAGWGFPVLFVGTWAGCKWAFEDTACWDLEDSSPYWWIIKGPIILSVGVNFGLF
LNIIHVLLRKLEPAQGSLHTQSQYWRLSKSTLFLIPLFGIHYIFFNFLPDNTGLGIRLAL
ELGLGSFQGLIVAILYCFLNQEVRTEISRRWHGHDPELLPALRTCARWMMPSNSGVKVLT
SVS
Download sequence
Identical sequences ENSPCAP00000004250 ENSPCAP00000004250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]