SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000004382 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000004382
Domain Number 1 Region: 47-129
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.84e-21
Family SCAN domain 0.0019
Further Details:      
 
Domain Number 2 Region: 344-401
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4e-20
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 3 Region: 306-358
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000142
Family Classic zinc finger, C2H2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000004382   Gene: ENSPCAG00000004717   Transcript: ENSPCAT00000004672
Sequence length 429
Comment pep:known_by_projection scaffold:proCap1:scaffold_71499:6419:8215:1 gene:ENSPCAG00000004717 transcript:ENSPCAT00000004672 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALDLRTSFQQESSRNEPQLENGEFECTPKHGFQKPEGISGLQGTPLSVFEYSNNSYARQ
ELQRLQKLFHLWLQPEKHSKEEMIFQLALEQFIMNEPCRNRSALKEKWGSSGRNLEDFLE
DLSDDFMGPPAYVHVCMQGKEALFSENMPLRDVVAHLTKQLLARNSTEGNTRTPYPTHQD
ASVQMGKETEDSSNLSLKTTLVNDNICSQGNAVVSLQLIQEENCPKPEEAGAFSDSTESS
NTAGLSISGFQEGVLGRPYQDVPMEVDPGLISRQDVATPESAPAHQSNEGRSTGWRHQDT
FHETPKPLRCEECPKSFKYFSQLKAHQRRHKNERPFVCAECHKAFFEMSDLHVHQVIHRR
EKPFSCSTCDKSFSHRTNWQAHERIHTGEKPYVCSICGRSYRQSSTYHRHVKTHQKGTLK
GAPNTTEAS
Download sequence
Identical sequences ENSPCAP00000004382 ENSPCAP00000004382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]