SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000004483 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000004483
Domain Number 1 Region: 81-131
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000494
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 2 Region: 721-776
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000759
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 3 Region: 491-535
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000327
Family Classic zinc finger, C2H2 0.0026
Further Details:      
 
Domain Number 4 Region: 539-566
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000316
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 5 Region: 629-657
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000144
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 6 Region: 584-619
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000666
Family Classic zinc finger, C2H2 0.058
Further Details:      
 
Weak hits

Sequence:  ENSPCAP00000004483
Domain Number - Region: 138-170
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00364
Family Classic zinc finger, C2H2 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000004483   Gene: ENSPCAG00000004757   Transcript: ENSPCAT00000004783
Sequence length 891
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_7258:22204:29019:-1 gene:ENSPCAG00000004757 transcript:ENSPCAT00000004783 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDPFCVGGGRRLPGSSKSGPGKEAGRNEVRLPVLHDPPKLGVPVVRSGQMVPSQAPLCF
DPGTAAGDRTEGKKKGRPKAENQALRDIPLSLMNQWKDEFKAHSRVKCPNSGCWLEFPSI
YGLKYHYQRCQGGAISERLTFPCPFCEAAFTSKTQLEKHRIWNHMDRPLPAPKPGPVSRP
VTISRPVGVSKPIGVSKPVTIGRPVGVSKPIGISKPVPVSRPVPITKPVTVSRPVPVTKP
VTVRPVPVTKSIPVTKPTPVTKTVPVTKSIPVTKPVTVSRPMPVTKPVPVTKPVTITKPM
PVTKPVTVSRPVAVSRPTPPCKMVLLTKAENRSARAVGRSSGKKRAADGLDACPVPHKQA
RPENGECGPSTADQSPGFQQGADVRSGLLSPGSRTSGGKETARATGPVCPNEEDPERMKH
RGNRKTPKKVTGEQPSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXPVAHPAPGGREEQWQRALHERGEAVCPTCSVVTRKTLVGLKKHMEVCQKLQDAL
KCQHCRKQFKSKAGLNYHTMAEHSAKPSDAEASEGGVQEERERLRKVLKQMGKLRCPQEG
CGAAFSSLMGYQYHQRRCGKPPCELDSPSFPCAHCGKTYRSKAGHDYHVRSEHAAPPPEE
PLDKPPEAEDLLGVERTPSGRIRRTSAQVAVFHLQEIAEDELARDWTKRRMKDDLVPETT
RLNYTRPGLPTLDPQLLETWKSEVKEKGNVNCPNDGCEAIYSSVSGLKAHLASCSKXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXNWFRTSADPPSKHRSQDSLTPQKEKKSTGGG
KKRGRRPRERPPEEPTLKLPPRRDDWPSGGRDKGGRGSAGRKVGAGKAPEK
Download sequence
Identical sequences ENSPCAP00000004483 ENSPCAP00000004483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]