SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000005095 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000005095
Domain Number 1 Region: 74-107
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000511
Family LDL receptor-like module 0.0055
Further Details:      
 
Domain Number 2 Region: 121-150
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000589
Family LDL receptor-like module 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000005095   Gene: ENSPCAG00000005497   Transcript: ENSPCAT00000005448
Sequence length 200
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_7376:6889:15064:-1 gene:ENSPCAG00000005497 transcript:ENSPCAT00000005448 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKVFPQGDVNGNLATQTKAGCSPLCCSHRGACLLASVLLLLAALAALITLVVILGLPPR
TPGSQACVTPTNRTGFLCHDGRTCILASGVCDSVHNCVYGEDEDESLCRDVPHSLPSFLV
ARCGDPDFWIYSDQRCDGINSCGDCSDELSPXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXX
Download sequence
Identical sequences ENSPCAP00000005095 ENSPCAP00000005095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]