SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000005864 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000005864
Domain Number 1 Region: 408-484
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000301
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 
Domain Number 2 Region: 336-373
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000279
Family Ras-binding domain, RBD 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000005864   Gene: ENSPCAG00000006236   Transcript: ENSPCAT00000006276
Sequence length 1241
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_3564:76636:135606:-1 gene:ENSPCAG00000006236 transcript:ENSPCAT00000006276 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLDSDKPMEPVKRSPLRQETNMANFSYRFSIYNLNEALNQGETVDLDALMADLCSIEQEL
SSIGSGNTKRQITETKATQKLPASRHTSKHGTLKGLSSSSNRITKPSLANYSLDDITAQL
EQASLSMDEAAQQSVLEDTKPLVTNQHRRTASAGTVSDTEVRSISNSSHSSITSAASSMD
SLDIDKVTHPQELDVVHQGQPITEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXEEQAAKLKAEKIRVALEKIKEAQVKKLVIRVHMSDDSSKTMMXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRIFEDHENLVENLLNWTRDSPNKL
IFMERIEKYALFKNPQNYLLGRKETAEMADRNKEVLLEECFGGSSVAVPEIEGVLWLKDD
GKKSWKKRYFLLRASGIYYVPKGKAKVSRDLVCFLQLDHVNVYYGQDYRNKYKAPTDYCL
VLKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXSQSNHSNQSDSGVSDTQPAGHVRSQSIVSSIFSEAWKRGTQLE
ESSKARMESVSRPYTSLMPPLSPQPKIVTPYTASQPSPPLPPPPPPPPPPPPPPPPPPPP
LPSQSAPSSGSAATVFVKYSTITRLQNASQHSGPLFKPPPPPVVSQSVKTQILVPPNGVV
PPPPPPPPPTPGSSMAQLKPAPCGPSIPQFPRPPPTPAPLPPQAPPKPLVTIPPPMGART
GLPVVTQAVPPTPILTPPVPPAKKQPPFPVSQVPPSPAVPPGPVPPPTLPKQQSFSVKPP
PSPLSPVPSVVKQIASQFPPPPTPPPVESQPIKPIPASITPQSPPAVKAKPKWQPSSAPA
PAPSPDFPPPPPDSTLVFPPPPPPPLPPPPPAVPTAASTPDKSGSPGKKTSKMSSPGGKK
PPPTPQRNSSIKASSCAEHTEPKRPSVDSLVSKFASPAEPSGSPSKEMPPPAAPPKPGKL
HLSGVNLPSILQQGCMSAKASALSGPGKDSMVEFPSPPSDSDFPPPPPEIELPLPPIEIP
AVFSGNTSPKVAVVNPQPQPWSKTSVKKAPPPTRPKRNDSTRLTQAEVPEQPAMATVVPQ
VPTSPKSGLSVQPGFLADLNRTLQRKSITRHGSLSSSRMSRAEPTATMDDMALPPPPPEL
LSDQQKASYGGSHISGYATLRRGPPPAPPKRDQNTKLSRDW
Download sequence
Identical sequences ENSPCAP00000005864 ENSPCAP00000005864

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]