SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000005878 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000005878
Domain Number 1 Region: 179-332
Classification Level Classification E-value
Superfamily Ribonuclease H-like 5.49e-24
Family DnaQ-like 3'-5' exonuclease 0.0012
Further Details:      
 
Domain Number 2 Region: 455-613
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.5e-16
Family Canonical RBD 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000005878   Gene: ENSPCAG00000006265   Transcript: ENSPCAT00000006290
Sequence length 698
Comment pep:novel genescaffold:proCap1:GeneScaffold_38:40899:64080:1 gene:ENSPCAG00000006265 transcript:ENSPCAT00000006290 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RARLSTILFAENCEVTHSQLCELLKYAVLGKSTFSKPSWCQLLHQNYLSNVVVFVLQGMS
QLHFYKFYLEFGFLRRAFRHKFRLPPPSSDFLADIIGLQKKQTNGGLPRTVEGPEASASI
NLQNNPIIKKFGFKRVGLNRCLLTKEEMRIFHFPLPGSSDCENFVSTKCNGSITESSRLF
GLDCEMCLTSKGRELTRVSLVAEGGYCIMDELVKPDNRIVDYLTSFSGITEQILSPVKTR
LKDVQRQLKALLPPDAVLVGHSLDLDLRVLKMMHPYVIDTSLLYVREQGRRFKLKFLARA
ILGKDLQRPDGIGHDVIENARTSLELACYFLKYGPKKIAELNLEAYASYRELQAAGQEPR
RRTETVQQPSTSVLDCLDSVGHKLLFLTREKDVTELSSSRNCESVKCFSNKEVLEQARVE
IPLFPFTVVQFSFEPFSPSLTEEMNQRMKVKWAEMSTIYAGPFNKNCNLKALKKLFKSFG
PFRSVSLVLETHQPHLCILYEVLEAAQLAIETLDGVLLEGISIKVQRPVTELTLDSDTLV
KELEQDSENQGTIYLSGVNESFKEQLLEKSHLFCGLEAIILPKHLKSGKQKRYCFLKFRN
FATAQKALKILTSKDWKLKGRPALTPRHLHAWLRGLPADSRRPPGTRVLPPPSEQQALQV
LTVDYPKIAAWRWGRKIGKLYHSLCPGTLCLILLPGTK
Download sequence
Identical sequences ENSPCAP00000005878 ENSPCAP00000005878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]