SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000006731 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000006731
Domain Number 1 Region: 53-331
Classification Level Classification E-value
Superfamily L domain-like 6.46e-60
Family Ngr ectodomain-like 0.0016
Further Details:      
 
Domain Number 2 Region: 238-556
Classification Level Classification E-value
Superfamily RNI-like 1.41e-54
Family 28-residue LRR 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000006731   Gene: ENSPCAG00000007244   Transcript: ENSPCAT00000007194
Sequence length 605
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_3613:46826:49367:-1 gene:ENSPCAG00000007244 transcript:ENSPCAT00000007194 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGDKGVQALALLALCWLATGRCGLEGVEPGAPGDADSLQCPAVCACSYDDYTDELNVFC
SARNLTQLPAGIPEDTRALWLDCNNLTSIPTAAFQNLSGLDFLNLQGSGLGRLAPHALLG
LGSLYHLHLEQNQLRSLAPGTFAHTPGLASLNLHHNLLSRLDEGLFAGLPHLWALNLGWN
GLAVLPDAAFQGLAGLRELVLAGNRLSYLQPPLFCSLGELQELDVSRNALRGVKAGVFAK
LPKLQKLYLQRNLIASVAPAAFLGLRALRWLDLSHNRVAGLFADTFPGLLGLRVLRLSHN
ALTGLRPRTFKDLHVLEELRLDHNRIRQLAEHTFEGLGRLEVLTLDHNQLQELRPGAFLG
LASVAVMNLSGNCLENLPEQVFQGLGRLHSLHLEASCLGRVRPHTFSGLAGLRRLSLRDG
GITGLDEQSLQGLPELRELDLTANRLAHLPRQLFHGLGKLEYLLLARNRLTELSPDTLQP
LQRAFWLDLAHNSLQSLAESVLAPLQRLRHLSLANNSLRAFAPQPPGLELLWLQGNPWDC
SCALRALWAFAQQNPRAVPRAVQAAPEVDDRQLPVYTYNNITCTGPPAVAGIDLRDLGEA
HFVHC
Download sequence
Identical sequences ENSPCAP00000006731 ENSPCAP00000006731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]