SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000006985 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000006985
Domain Number 1 Region: 186-374
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 9.75e-40
Family Asparaginyl hydroxylase-like 0.068
Further Details:      
 
Domain Number 2 Region: 1086-1280
Classification Level Classification E-value
Superfamily RNI-like 1.18e-20
Family 28-residue LRR 0.075
Further Details:      
 
Domain Number 3 Region: 656-734
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000288
Family PHD domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000006985   Gene: ENSPCAG00000007401   Transcript: ENSPCAT00000007463
Sequence length 1280
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_987:1101:90281:-1 gene:ENSPCAG00000007401 transcript:ENSPCAT00000007463 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KTADPHVGSEGSAEDAPLRKKHAAEKQKKKTICPKCFAFGLATRPIDRQRYDENEDLSDV
EEIVSVRGFSLEEKLRSQLYQGDFVHAMEGKDFNYEYVQREALRIPLIFREKDGLGIKMP
DPDFTVRDVKLLVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXHLVKRPTVIDLVDWVDNMWPQHLKEKQTEATNAIAEMKYPKVKKYCLMSVKGCFT
DFHIDFGGTSVWYHVFRGGKIFWLIPPTLHNLALYEEWVLSGKQSDIFLGDRVERCQRIE
LKQGYTFFIPSGWIHAVYTPVDSLVFGGNILHSFNVPMQLRIYEIEDRTRVQPKFRYPFY
YEMCWYVLERYVYCVTQRSHLTQEHQRESMLVDVPRKPSVDGFSSDSWLEMDEESSEQNP
PEEEEEKKEQEEGGEKVPKLPVDGPTSPPSTPSEDPEAPGKKPKAPATRFLKRTLSNESE
ESVKSAMVPGDCPKTPTGSPPTDISAKWTHLTEFELKGLKALVEKLESLPENKKCVPEGI
EDPQALLEGVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXAGARRRRTRCRKCEACLRTECGECHFCKDMKKFGGPGRMKQSCIMRQCIAPVLPH
TAVCLVCGEAGKEDTVEEEEGKFNLMLMECSICNEIIHPGCLKIKESEGVVNDELPNCWE
CPKCNHAGKTGKQKRGPGFKYASNLPGSLLKEQKMNRDNKEGQEPAKRRSECEEAPRRRS
DEHPKKVPPDGILRRKSDDVHLRRKRKYEKPQELSGRKRASTLPTSPGSSSHLSPRPPLG
SSLSPWWRSSLTYFQQQLKSGKEDKLFRKKRRSWKNAEDRMALGNKPLRRFKQEPEDDLP
EAPPKPRERESDHSRSSSPTAGPSTEGAEGPEEKKKVKMRRKRRLPNKELSKELSKELNQ
EIQKTENSLANENHQPIKSEPESENEEPKRPLGFCERPHRFSKGLNGTPRELRHQLGSGL
RSPPRVISRPPPSMSPPKCIQMERHVIRPPPISPPPDSLPLDDGAAHVMHREVWMAVFSY
LSHPDLCVCMRVCRTWNRWCCDKRLWTRIDLNHCKSITPLMLSGIIRRQPVSLDLSWTNI
SKKQLSWLINRLPGLRDLVLSGCSWIAVSALCSSSCPLLRTLDVQWVEGLKDAQMRDLLS
PPTDNRPGQMDNRSKLRNIVELRLAGLDITDASLRLIIRHMPLLSKLHLSYCNHVTDQSI
NLLTAVGTTTRDSLTEINLS
Download sequence
Identical sequences ENSPCAP00000006985 ENSPCAP00000006985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]