SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000007184 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000007184
Domain Number 1 Region: 343-399
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.85e-24
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 2 Region: 399-455
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.48e-24
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 3 Region: 455-511
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.84e-23
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 4 Region: 496-548
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.22e-22
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 5 Region: 287-343
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.1e-22
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 6 Region: 248-300
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.58e-19
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 7 Region: 14-64
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000000034
Family KRAB domain (Kruppel-associated box) 0.0028
Further Details:      
 
Domain Number 8 Region: 126-172
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000614
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Weak hits

Sequence:  ENSPCAP00000007184
Domain Number - Region: 193-229
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000137
Family Classic zinc finger, C2H2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000007184   Gene: ENSPCAG00000007673   Transcript: ENSPCAT00000007677
Sequence length 625
Comment pep:known_by_projection scaffold:proCap1:scaffold_28698:8310:14549:1 gene:ENSPCAG00000007673 transcript:ENSPCAT00000007677 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAATLMHPARGCVFEDVIYFSQEEWGLDETQRLLYCSVMLENFALTASLGLLSFRSHVV
AQLEMGMEFWMPDRVDITPDLAAGACRGPGSGFWHGMECHESASEHSAFIGVPQDRNPYA
DLSLQKDYSCDMSGVFLKDTVHLVENQATHPNQKLYMCGAFGRGFRFSANLHLQQMQQNV
EKRKGREEGTASFVKRCRTHLSGKPFMCREDGKDFMARSGFFQHRVTHNLGELHRNTESV
VGVHTAQRSYKCSECGKTFNDKSTLVQHQTIHAGERPYKCGICGKFFTSATSLIQHQKIH
TKERRYECSECGKSFSQCSSLFQHQRVHTGEKPYECHECGKFFRHISSLIKHRRVHTGEM
PYECGECGKFFSQSSNLIQHQRVHTGERPYECSECGKLFSQSSNLIKHRRVHTGESPHEC
SECGKAFSYNSNLIKHRRVHTGERPYKCNECEKFFSHISSLIKHRRIHTGEQPYECSECG
RFFSQSSSLSNHRRLHTGERPYACNECGKAFSQSSDLMKHQRVHSGERPYKCSDCGKAFS
QKSNLIQHQKLHRPDRPYCSRGRAFSNLVWHWTIRRAERSARNVLLCCSTQLTSETISEN
NLHEGTIGHKWNFFHPNSHSGEVPN
Download sequence
Identical sequences ENSPCAP00000007184 ENSPCAP00000007184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]