SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000007404 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000007404
Domain Number 1 Region: 505-569,611-708
Classification Level Classification E-value
Superfamily PH domain-like 4.2e-31
Family Pleckstrin-homology domain (PH domain) 0.0047
Further Details:      
 
Domain Number 2 Region: 1129-1261
Classification Level Classification E-value
Superfamily Second domain of FERM 3.4e-18
Family Second domain of FERM 0.0073
Further Details:      
 
Domain Number 3 Region: 715-820
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000384
Family Pleckstrin-homology domain (PH domain) 0.0092
Further Details:      
 
Weak hits

Sequence:  ENSPCAP00000007404
Domain Number - Region: 1030-1107
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00127
Family Ubiquitin-related 0.082
Further Details:      
 
Domain Number - Region: 125-164,616-636
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0136
Family BAR domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000007404   Gene: ENSPCAG00000007785   Transcript: ENSPCAT00000007913
Sequence length 1400
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_388:32749:72025:1 gene:ENSPCAG00000007785 transcript:ENSPCAT00000007913 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RTQGQRRARAKGVRVPGARRGRPRARRALNFDIGSIMAELKMETRASVDWQKRCLALETQ
LFRFRLQASKIRELLADKXXXXXXXXXXXXXXXXXXXXXVGVMEEKVKQSNLKSVDSAGS
LHWKYQELLKVMQAKDKLINQLEAQLEKQEQMRAEEAKVIQEKAAKIKEWVTLKLAELEM
ENQHLKSCNQSLVEQVGALQNALEAIHMPPSGKLLVALQETPKQDAATSGSGTQPFRQDS
GPQTKGSMKVAMPAPSPDAFQNKDSVPGAGSPLDSSGSSLVHCGKRAEAKSPEAHLGREC
SPGQLCLKPHTPRCSTSWGEDLVRAHGGTLSGTKISPREGGPGTSLTLPKARASGIPRDS
IQLXXXXXXXXXXXXXXXXXXLSIGIGALSALHPSSLFKGKTGAELQEELEKMEMEEPPP
VGKKEGRESLKIPGADLGEVELGNKPPTPPLHRFPSWESRIYALAISGMQLSDAAPRSNT
ASYASSPPALASSGPFSGLVYKNITVPVFTALKGRATQISSMPFVDESSGSDDDCSSQAS
FRTSVPCSESRKTSALGSPRAIKRGVSMSSLSSEGDYAIPPDACSLDSDYSEPEHKLQRT
SSYSTDGLGLGTESLEKSGYLLKMGSRVKTWKRRWFVLRQGQIMYYKSPSDVIRKPQGQV
ELNSRCQIVRGEGSQTFQLISEKKTYYLTADSPSLLEEWIRILQTLLKVQATGPPALPHG
GTKPTVKGWLTKVKHGHSKLVWCALIGKTFYYYRSHEDKRPLGHLPMRDARIEEVDRSCD
SDEDYEAGGTGRLLSSHRTLVIYPPEHSPTYLLIGTKHEKXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXSPLWRHPMLCYSKDGLYTSLTTLPSEALQTEALKLFKSCQLFI
NVPVEAASVDYHVSLAQTALQVCLVHPELQSEIYCQLMKQTSCRPPQKYSLMQCWQLLAL
CAPLFLPQHHFLWYIKQQLQRHADPRNETGQYATYCQRAVERTLQTGEREARPSRMEVVS
ILLRNPFHHSLPFSIPVHFANGTYQVVGFDGSSTIDEFLQRLNQETAMRKSSHSGFSLFT
DDPSGRDLEHCLQGSVKICDVISKWEQALKELHPGKSEGGTRIVKLMYKNRLYFRSQVKG
ETERERLLLASQTSGEVVAGRFPVNKELALEMAALMAQVEYGDLEKPIQPGPGGTPPAKA
QHLLQQVLDKFYPKRYRHGAPPEQLRHLTDMLTTKWGALQGCSPSECLRIYLTVARKWPF
FGAKLFTAQPAQLSSKENAVVWIAVNEDGVSILDHNTMQVHVTYXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXIAEATLLMASYMNHCSATGNPPANPPASRQPWE
LDGQQLFASIPHGTKEPALL
Download sequence
Identical sequences ENSPCAP00000007404 ENSPCAP00000007404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]