SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000007625 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000007625
Domain Number 1 Region: 1112-1288
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 6.08e-41
Family BCR-homology GTPase activation domain (BH-domain) 0.00056
Further Details:      
 
Domain Number 2 Region: 896-1027
Classification Level Classification E-value
Superfamily PH domain-like 5.75e-22
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Domain Number 3 Region: 1420-1555
Classification Level Classification E-value
Superfamily PH domain-like 3.85e-19
Family Pleckstrin-homology domain (PH domain) 0.026
Further Details:      
 
Domain Number 4 Region: 674-789
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.44e-17
Family Pyk2-associated protein beta ARF-GAP domain 0.011
Further Details:      
 
Domain Number 5 Region: 485-562
Classification Level Classification E-value
Superfamily PH domain-like 2.89e-17
Family Pleckstrin-homology domain (PH domain) 0.0000323
Further Details:      
 
Domain Number 6 Region: 572-673
Classification Level Classification E-value
Superfamily PH domain-like 9.56e-16
Family Pleckstrin-homology domain (PH domain) 0.02
Further Details:      
 
Domain Number 7 Region: 7-72
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000000173
Family SAM (sterile alpha motif) domain 0.000096
Further Details:      
 
Domain Number 8 Region: 1004-1104
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000767
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Weak hits

Sequence:  ENSPCAP00000007625
Domain Number - Region: 1316-1392
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0238
Family Ras-binding domain, RBD 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000007625   Gene: ENSPCAG00000008036   Transcript: ENSPCAT00000008152
Sequence length 1693
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_331:12337:227115:-1 gene:ENSPCAG00000008036 transcript:ENSPCAT00000008152 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSVSEINVDIKDFLMSINLEQYLSHFRDFGLNTVKDCAAINDSLLHKIGISPTGHRRIL
KQLHILLSKMHDTPIYANIHKTKNDETPKDICAVSSDXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
YLRERKNVTTSAGKLVAQQNSNEENSSSFSYGEFLFXXXXXXXKKSIKNEFWTHEDTLKR
EAAAERIYDNRTEKASEDKVEDIWIPREDKNNVPVDSASESEYSTVEECFHSLRRKNSKA
SKSRTHKVLNPDPLTRHSYPCSSPSGKAKSSTISSYAISPXXXXXXXXXXXXXXXXXXXX
XXXXKRMFQKRWVKFDGLSISYYNNEKEMYSKGIIPLSAVSTVRIQGDNKFEVVTTQRTF
VFRVEKEEERNDWISILLNALKTQSLTSQSQAVVAPEKCGYLELRGYKAKIFTVLSGNSV
WLCKNEQDFKSGLGITIIPMNVANVKQVDRTVKQSFEIITPYRSFSFTAESEKEKQEWIE
AVQQSIAETLSDYEVAEKIWFNESNRSCADCKAPDPDWASINLCVVICKKCAXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXLFIVIGNKRANDFWAGNLHKDEELHMDSPEEKRKNFIIQ
KYKEGRFRKTLLASLTKQELNKALCAAVVTPDVLETMALLFSGADVMCATGDPMHSTPYL
LAKKARQSLQMEFLYHNKFSDFPQHDIPSEGGLSQEFSQSTFLCDFLYQAPAAASKLSSE
KKLLEEPNKKWCVLEGGFLSYYENDKSTTPNGTINISDVVCLAIHKEDFYLSTGPVFTFE
IYLTSERVFLFGAETSQAQRRWTEAIAKHFVPFIAENLTEADYDLVGQLYYKDCHALDQW
RKGWFAMDKSTLRFCLQMQEAQEDRMHLRRLQELTISTTVQNGEKLDVLLLVEKGRTLYI
HGHTKLDFTVWHSAIEKAAGTDGNALQDQQLSKNDVPIIVNSCIAFVTQYGLGCKYIYEK
NGDPLHISELLESFRKDARSVKLRAGKHQLEDVTGVLKSFLSDIDDALLTKELYPYWISA
LDTQDAKERITKYGTFIRTLPVVNRATLAALMEHLYRVQKCSEINQMNAHNLAMAFSSCL
FQTNGQTSEEVNVIEDLINNYVEIFEVKEDQVKQMDIENSFITKWKDTQVSQAGDLLIEV
YVEKKDPDCSIIIRVSPVMEAEELTNDILAIKNITPKKGDIWATFEVIENEELERPLHYT
ENVLEQVLQWSSLAEPGSAYLVVKQFLTTDTIKLYSERSAQESIKEGVLKIKEEPSKILS
GNKFQERYFVLRDGYLFLYKDLKSSKHDKMFSLSSMKFYLGVKKKMKPPTSWGLTAYSEK
HHWHLCCDSLQTQMEWMTSVFIAQHENDLWPPAGQQRKRSITKNPKIGGLPLIPIQQEKN
ATLARRSIESAREELDRLRLSAKPDKDSVDCTLRERASIVAHCLEHKEEKLRNRTRKHRS
FNCLEDTGAEVPPGQQKFSKAIKTLRKTEDRNGKATLDSDNKLPSKVIEELNVVLQRTRM
LPKELKDEPILQK
Download sequence
Identical sequences ENSPCAP00000007625 ENSPCAP00000007625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]