SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000007943 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000007943
Domain Number 1 Region: 161-255
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.38e-29
Family Ras-binding domain, RBD 0.00013
Further Details:      
 
Domain Number 2 Region: 477-544
Classification Level Classification E-value
Superfamily SH2 domain 4.71e-16
Family SH2 domain 0.0000425
Further Details:      
 
Domain Number 3 Region: 284-399
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000377
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000007943   Gene: ENSPCAG00000008469   Transcript: ENSPCAT00000008502
Sequence length 545
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_1601:6472:102083:-1 gene:ENSPCAG00000008469 transcript:ENSPCAT00000008502 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALAGCPDSLLHHPYYQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDDVDLEALVNDMN
ASFESLYSACSMQSETVPLLQNGQHIRSPLPSSGTRVLQPPASQRQKVQRSQPVHILAVR
RLKEEDQQFRTSSLPAIPNPFPELCSGGSSPVLSPGSLPPSQSMAKQDVKVFSEDGTCKV
VEILADMTARDLCQLLVYKSHCVDDNSWTLVEHHPHLGLERCLEDHELIVQVESTMGSES
RFLFRKNYAKYEFFKNPMXXXXXXXXXXXXXXXXXXXXXXXNFLNSSSCPEIQGFLHVKE
LGRKSWKKLYVCLRRSGLYCSTKGTSKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXPNKVRNETKELRLLCAEDEQSRTCWITAFRLLKYGMLLYQNYRIPQQRKALLSPFS
TPVRSVSENSLVAMDFSGQTGRVIENPAEAQSAAVEEGHAWRKRSTRMNILGSQSPLHPS
TLSTVIHRTQHWFHGRISREESHRIIKQQGXXXXLFLLRDSQSNPKAFVLTLCHHQKIKN
FQILP
Download sequence
Identical sequences ENSPCAP00000007943 ENSPCAP00000007943

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]