SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000007975 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000007975
Domain Number 1 Region: 7-118
Classification Level Classification E-value
Superfamily POZ domain 2.75e-25
Family BTB/POZ domain 0.00081
Further Details:      
 
Domain Number 2 Region: 771-811
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.71e-22
Family Classic zinc finger, C2H2 0.00077
Further Details:      
 
Domain Number 3 Region: 705-746
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.26e-16
Family Classic zinc finger, C2H2 0.001
Further Details:      
 
Domain Number 4 Region: 747-770
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000171
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 5 Region: 908-958
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000605
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 6 Region: 542-592
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000107
Family Classic zinc finger, C2H2 0.033
Further Details:      
 
Domain Number 7 Region: 667-697
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000127
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Weak hits

Sequence:  ENSPCAP00000007975
Domain Number - Region: 1028-1064
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000607
Family Classic zinc finger, C2H2 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000007975   Gene: ENSPCAG00000008566   Transcript: ENSPCAT00000008535
Sequence length 1065
Comment pep:known_by_projection scaffold:proCap1:scaffold_33704:11713:15159:-1 gene:ENSPCAG00000008566 transcript:ENSPCAT00000008535 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGLLHYINPAHAISLLSALNEERLKGQLCDVLLIVGDQKFRAHKNVLAASSEYFHSLFT
NKENESQTVFQLDFCEPDAFDNVLNYIYSSSLFVEKSSLAAVQELGYSLGISFLTNIVSK
TPQAPFPTCPSRKKVFIEDDESNSQKRSVIVCHSKNEAQATVSQNPPDVSHTARPLPSPA
TKTSTSKSHVKPIDPLHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSVHSSSEAPYLLEGTNRGGGQG
EDRNLLYYSKLGLVIPSSGPGSGNQSIDRSGPLVKSLLRRSLSMDSQVPMYSPSIDLKSS
QGSSSRSNDAPGIVLCPLSQKSSLKDGSEKVALDDRTAVLPPHRLRSFSASQSTDREATS
PITEVCIKTEPSSPLSDPSDIIRVTVGDAAAATAAASLSAVTRDLSLKTEDDPKEMSRLP
AKRRFQADRRLPFKKLKGSEHGSPVSEDNCEDGASPPLLQADLPDSDLNKDEFGELEGTR
PNKKFKCKHCLKIFRSTAGLHRHVNIYHNPEKPYACDICHKRFHTNFKVWTHCQTQHGIV
KNPSPASSSHAVLDEKFQRKLIDIVREREIKKALIIKLRRGKPGFQGQASSQAQQVIKRN
LRSRAKGAYICTYCGKAYRFLSQFKQHIKMHPGEKPIGVNRVTKPKEHVPLESPVESKEV
YQCRLCNAKLSSLLEQGNHERLCRNATVCPYCSLRFFSPELKREHESKCEYKKLTCLECM
RTFKSSFSIWRHQVEVHNQNTMVPTENFSLPILDHNGEITGSTRPHSQSEPNKVNHVITA
KDDNVFSDSPEQINFDSEDSSCLPEDLSLSKQLKIQVKEEPVEEAEEEVPETSVTPKETG
TSKDTGLWPCEKCGKMFSVHKQLERHQELLCSVKPFICHVCNKAVRTNFRLWSHFQSHMS
QTTEESVRKESEVCSAPTNSPSPPPLPPPPPLPKIQPLEPDSPTAQSENPTPAVEKMFAP
QESETLFYHAPPLSAITFKRQFMCKLCHRTFKTAFSLWSHEQTHN
Download sequence
Identical sequences ENSPCAP00000007975 ENSPCAP00000007975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]