SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000007984 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000007984
Domain Number 1 Region: 542-599
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.23e-21
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 2 Region: 166-218
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.66e-20
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 3 Region: 124-181
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.72e-20
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 4 Region: 486-543
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.74e-20
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 5 Region: 448-500
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.07e-19
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 6 Region: 68-125
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.46e-18
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 7 Region: 584-636
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.44e-18
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 8 Region: 32-82
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.15e-17
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 9 Region: 360-412
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000688
Family Classic zinc finger, C2H2 0.04
Further Details:      
 
Domain Number 10 Region: 244-266,293-317
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000379
Family Classic zinc finger, C2H2 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000007984   Gene: ENSPCAG00000008589   Transcript: ENSPCAT00000008545
Sequence length 789
Comment pep:known_by_projection scaffold:proCap1:scaffold_18109:31081:33471:-1 gene:ENSPCAG00000008589 transcript:ENSPCAT00000008545 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVGSHVDMAPTSTTEGGGEKPGPVASAPAAQYECGECGKAFRWSSRLLHHQRTHTGERPY
KCPDCPKAFKGSSALLYHQRGHTGERPYQCPDCPKAFKRSSLLQIHRSVHTGLRAFTCGQ
CGLAFKWSSHYQYHLRQHTGERPYLCLDCPKAFKNSSSLRRHRHVHTGERPYTCTVCGKS
FTQSTNLRQHQRVHTGERPFRCALCPKTFTHSSNLLLHQRTHGAAAPATTPAPGTATPPP
PPQHRCEPCGKVFVSDAYLQRHLQSHGPPVPPAPTPAPPPVVPELFLAAAETTVELVFRC
DGCELGFGSEELLLEHQPCPGPEVAPPPPDPPTAPSAPKPDPPPAVSPPSPLQPATAPSF
ACLPCGKSFRTVAGLSRHQHSHGTASGQAFRCGSCDGAFPQLASLLAHQQCHVEEAAAGR
PPPQAEAAEVTCPQDPPPPPPTAAPAERPYKCAECGKAFKGSSGLRYHLRDHTGERPYQC
GECGKAFKRSSLLAIHQRVHTGLRAFTCGQCGLTFKWSSHYQYHLRLHSGERPYACGECG
KAFRNTSCLRRHRHVHTGERPHACSVCGKSFAQTSNLRQHQRVHTGERPFRCALCPKTFT
HSSNLLLHQRTHSAERPFTCSVCGRGFVMAAYLQRHLRTHAPANTAPSSAGPQPPAPLAA
APPATQDVHVLPHLQATLSLEVAGGPAQAPSLGPATPNSQTFLLVQTAHGLQLIPSSVQP
PTPPPPPAPPKLILLPSPSASGGGGRASQGPRAVAKAGQGAGVVWLPTPGGLGVQGGASP
GTNGGGQSL
Download sequence
Identical sequences ENSPCAP00000007984 ENSPCAP00000007984

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]