SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000008000 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000008000
Domain Number 1 Region: 975-1127
Classification Level Classification E-value
Superfamily FAS1 domain 8.76e-28
Family FAS1 domain 0.002
Further Details:      
 
Domain Number 2 Region: 1731-1878
Classification Level Classification E-value
Superfamily FAS1 domain 2.49e-24
Family FAS1 domain 0.004
Further Details:      
 
Domain Number 3 Region: 521-655
Classification Level Classification E-value
Superfamily FAS1 domain 8.5e-24
Family FAS1 domain 0.002
Further Details:      
 
Domain Number 4 Region: 1134-1263
Classification Level Classification E-value
Superfamily FAS1 domain 2.62e-19
Family FAS1 domain 0.0083
Further Details:      
 
Domain Number 5 Region: 396-503
Classification Level Classification E-value
Superfamily FAS1 domain 7.59e-18
Family FAS1 domain 0.0023
Further Details:      
 
Domain Number 6 Region: 1645-1724
Classification Level Classification E-value
Superfamily FAS1 domain 4.97e-17
Family FAS1 domain 0.002
Further Details:      
 
Domain Number 7 Region: 2372-2446
Classification Level Classification E-value
Superfamily FAS1 domain 0.000000000106
Family FAS1 domain 0.0097
Further Details:      
 
Domain Number 8 Region: 939-992,1345-1469
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000847
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 9 Region: 1467-1520
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000562
Family EGF-like domain of nidogen-1 0.06
Further Details:      
 
Domain Number 10 Region: 2081-2117
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000046
Family EGF-type module 0.081
Further Details:      
 
Weak hits

Sequence:  ENSPCAP00000008000
Domain Number - Region: 1508-1558
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000446
Family EGF-type module 0.076
Further Details:      
 
Domain Number - Region: 2127-2160
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00227
Family EGF-type module 0.083
Further Details:      
 
Domain Number - Region: 727-871
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0895
Family Growth factor receptor domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000008000   Gene: ENSPCAG00000008251   Transcript: ENSPCAT00000008561
Sequence length 2545
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_3331:7650:194069:1 gene:ENSPCAG00000008251 transcript:ENSPCAT00000008561 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMLLHSIILFLGLAVPNFCSRTATTQQGKRCDKKSLLIHRTECRSCFLXXXXXXXXXXXX
XXXXXXXXXXXXYTLEIKTYFLSLPGCRHICRRDYLQPQCCPGHWGPDCMECPGGAMSPC
SGRGTCDEGMEGNGRCACQEGFGGTTCEICADDNLFGPNCSAVCSCVHGVCNSGIDGNGT
CECYSAYTGTNCTKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXFHCECKEHYYNFVPEVGCSVTDICETNNPCHRNARCATIAPGQTXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKVYAWPLSNLGPFTMLLPTDKGLKGFSV
QQLLTDTKAAEYFVKLHIIAGQMSTNHLNNTDTFYTLTGKSGEVFNRDKDNQLKLKLYGG
KKKVKIIQGNVIASNGLLHIIDRSMDKLGPTFESNTEKTIMTMLQPRYSKFRSLLEETNV
GYSFGQGVFRGPYTVFVPSNEALNNMKDGTLDYLLSPEGSRKLLELVRYHIIPFVQLEVA
ILIAYANVRTMANQLIHINTTNNGQILVNGVAMEEIDVAAKNGQIYTLNGVLIPPSIIPI
LPHRCDEIKREMKLXXXXXXXXXXXXXXXXXXXXXALYRPKCIYSSRQSGPTNGCARYCN
ATVKIPKCCRGYYGPDCNLCPGGFSNPCSGNGQCVDGIGGNGTCICEDGFQGSKCQFCSD
PNKYGPRCDKKCLCARGTCDNRIDSDRACLAGTCRDGSDGKFCNKQAHSCGPYMQFCHIH
AACVYSNGTASCICKAGYEGDGTLCSEADPCSELTPGGCSRNXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNECECKKGFQGNGIDCEPVNSCLEQ
TKKCHPLSCQSTSSGTSCVCPEGYEGDGLVCYGNAAVELSLLLEATIFNQWITDAALRSM
LSATSNLTVLVPSQQAVEDMDPGDKTFWLSKSNMPALVKYHTLLGIYGMADLQSLSSPDL
LATSLQGTFLHLEKVNGNITIEGASIIDGDIAATNAVIHVINKVLIPRRSLTRSLPNLLT
RLDQMPGYSIFRGYIIQYNLASVIEAADAYTVFAPDNNAIETYIREKKAATLEEDIVKYH
VVLEQKLLKNDLHNGMHRETMLGFSYLLGFFLRNDQLYVNEVPINYTNAATDKGVIHGLV
KVLEIQKNRCDNNDIVIVRGNCGKCLQQLHCPLGTKQLXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXMRECCTGFFGPECQPCPGKAGNACFGNGICLDGANGTGVCQCGEGFNGTA
CESCYEGRYGIHCDQVCPCVHGRCNQGPSGDGSCECDVGWRGVHCDIEITTDNCNGTCHS
SANCLLNSDGTASCKCAAGFQGNGTVCKAIDACAISHGGCSAKADCRRTTPGRRLCVCKA
GYTGDGIVCQDINPCLEHGGGHRNAECTQTGPQAVCNCLPTYTGDGKICTLINICLTXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXLEHWDQQRVMSQILRYHVIACHQLLLENLKSTPNATSLQ
GESIAISVSQDTVYLNNKAKIISSDIITTNGIIHIIDKLLSPQNLIVTPRDAFGRILQNL
TTVAKKHGYTKFSNLIQDAGLLTLITDPIHVPVTLFWPTDRALQALPAQQQDFLFNQENN
DKLKEYLKFHVIRDSKVSAVDLPRSAAWRTLQGSDLRVNCGPSSDAGALFLNGQTCRIVQ
RELVFDLGVAYGIDCLLIDPTLGGRCDTFASFNALGSCGSCTNTPKCPRYTKPKXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCPGGPDNPCNNHGTCQEAFWGTG
HCLCHTGSGTACEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVDFCKQNNGGCDKVAKCSQKGTL
VSCSCPKGYKGDGYSCMAIDLCADGLNGGCHEHATCKMTGPGKRRCECKSHYVGDGLNCE
TEQLPIDRCLQDNGQCHADADCSDLHFQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXTLSGRDIEYHLASVNIILYNDLVNGTTLQSRLGSQL
LITSSEDQSHLETRFVNGRAILQWDIFASNGIIHIISGPLKTPPTPVXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSEEDINAAALGKEQPENISNPVYDNTASAP
PEPSYDPFVESDEQQLMSSNLLGGL
Download sequence
Identical sequences ENSPCAP00000008000 ENSPCAP00000008000

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]