SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000008699 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000008699
Domain Number 1 Region: 35-147
Classification Level Classification E-value
Superfamily PH domain-like 4.92e-33
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0000763
Further Details:      
 
Domain Number 2 Region: 259-370
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 1.01e-18
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.000087
Further Details:      
 
Domain Number 3 Region: 428-489
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000000000144
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000008699   Gene: ENSPCAG00000009323   Transcript: ENSPCAT00000009321
Sequence length 501
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_173:14252:21357:1 gene:ENSPCAG00000009323 transcript:ENSPCAT00000009321 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGGPAGGRPGGRGGPGVQQNIPSTLLQDHENQRLFEMLGRKCWTLATAVVQLYLAVPPG
AEHWTKEHCGAVCFVKDNPQKSYFIRLYGLQXXXXXWEQELYSQLVYSTPTPFHTFAGDD
CQAGLNFADEGEAQSFHALVQEKIQKRNQRQTGERRQVLPALATTGEERRGVFPPLPPHP
SGDLGGPPAGPLALGLVTVDIQNPDITSSRYRGLPAPGPGPVDKKRSGKKKISKADIGAP
SGFXXXXXXXXXXXXXXXVNNLDPDLQSLFSRAGISEAQLTDAETSKLIYDFIEDQGGLE
AVRQEMRRQEPLPPPPPPTRGGNQPPRPPIVGGNKGRSGPLPPVPLGGTLPPPAPRGPPP
PGRGGPPPPPPPATGRSGPPPSLTPGAGGPPMPPPPPPPPPPPSSGEGPIAPLPPPALGS
WGGPAPAGSRGALLDQIRQGIQLNKTPGAPEGTALQPPVQSSEGLVGALMHVMQKRSRAI
HSSDEGEDQAGDDEEHEECHY
Download sequence
Identical sequences ENSPCAP00000008699 ENSPCAP00000008699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]