SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000008755 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000008755
Domain Number 1 Region: 313-370
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.72e-24
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 2 Region: 257-314
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.39e-22
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 3 Region: 369-421
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.91e-22
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 4 Region: 219-271
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.29e-21
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000008755   Gene: ENSPCAG00000009403   Transcript: ENSPCAT00000009383
Sequence length 421
Comment pep:known_by_projection scaffold:proCap1:scaffold_2390:22924:34736:-1 gene:ENSPCAG00000009403 transcript:ENSPCAT00000009383 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTELREAMALAPLGPVTVKKEEEEEENLLGQMTSQQLHSDSVKAWAREDSPQTDLQGSE
WKDKDQNMFWDMAVILKATQEPPAESPLGGYSLPGAIAKSEILETRGDMTLAAETKNPQS
LVLKTEMCDEAEKPFVIAGRIQKADPARPELGETCKKGKPLKKQRIKREKIDFRQGTVKD
CHLPESLKEEGDQKCLDSEERYGLSSRPVKNQKVQPGQKPFTCNVCGKGFSQSANLVVHQ
RIHTGEKPFECHECGKAFIQSANLVVHQRIHTGQKPYVCSKCGKAFTQSSNLTVHQKIHS
LEKNFKCSECEKAFSYSSQLARHQKVHITEKCYECNECGKTFTRSSNLIVHQRIHTGEKP
FACNDCGKAFTQSANLIVHQRSHTGEKPYECKECGKAFSCFSHLIVHQRIHTAEKPYDCS
E
Download sequence
Identical sequences ENSPCAP00000008755 ENSPCAP00000008755

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]