SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000009360 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000009360
Domain Number 1 Region: 61-184
Classification Level Classification E-value
Superfamily PH domain-like 6.97e-30
Family Pleckstrin-homology domain (PH domain) 0.0038
Further Details:      
 
Domain Number 2 Region: 762-937
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 2.62e-23
Family NAD kinase-like 0.06
Further Details:      
 
Domain Number 3 Region: 231-299
Classification Level Classification E-value
Superfamily Cysteine-rich domain 2.84e-16
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000755
Further Details:      
 
Domain Number 4 Region: 168-225
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000389
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0091
Further Details:      
 
Domain Number 5 Region: 1139-1204
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000739
Family SAM (sterile alpha motif) domain 0.0066
Further Details:      
 
Weak hits

Sequence:  ENSPCAP00000009360
Domain Number - Region: 329-359
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 0.0116
Family Diacylglycerol kinase-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000009360   Gene: ENSPCAG00000009918   Transcript: ENSPCAT00000010027
Sequence length 1212
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_1393:10243:135652:1 gene:ENSPCAG00000009918 transcript:ENSPCAT00000010027 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACGQQPPPGTAGGAAGAGAAVTLAAASVGPGDDSSDSEAEQEGPQKLIRKVSTSGQIRT
KTSIKEGQLLKQTSSFQRWKKRYFKLRGRTLYYAKDSKSLIFDEVDLSDASVAEASTKNA
NNSFTIITPFRRLMLCADNRKEMEDWISCLKSVQTRETYEVAQFNVEHFSGMHNWYACSH
ARPTFCNVCRESLSGVTSHGLSCEVCKFKAHKRCAVRATNNCKWTTLASVGKDTKGNEDD
VAMPHQWLEGNLPVSAKCIVCDKTCGSVLRLQDWRCLWCKAMVHTACKDVYHPVCPLGQC
KVSIVPPIALNSTDSDGFCRATFSFCVSPLLVFVNSKSGDNQGVKFLRRFKQLLNPAQVF
DLMNGGPYLGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWSIMTYELKLPPKAPLLPGPPGQPARF
YMTIYEDSVATHLKTILSTDEHAVVLSAANILCETVKDFVAKVEKEYGTTLENSDDADAM
ASTCSVLNEKLEQLLQALQMEAQASVTPGLRPVIAEEDPVESSSEESLSDHKEQLADEVT
SSQKTVKPTEIMLRANSLKKAVRQVIEHAKKGTDEQVVQPSEPVNELPEYDGTETAEPKE
ESKDDDARESLPVKTAPRSPDSRAAHSHFQSEPSSSGPAVAASKESLPVLNTRIICPGLR
AGLAASIAGSSIINKMLLANIDPFGAMPFIDPDPDSLDGYTEKCVMNNYFGIGLDAKISL
EFNNKREEHPEKCRSRTKNLMWYGVLGTRELLQRSYKNLEQRVQLECDGQYIPLPSLQGI
AVLNIPSYAGGTNFWGGTKEDDMFTAPSFDDKILEVVAIFDSVQMAVSRVIKLQHHRIAQ
CRAVKITIFGDEGLPVQVDGEAWVQPPGIIKIVHKNRAQMLTRDRAFENTLKSWEDKQRC
DSGKPVIRTHLYIHHAVDLATEEVSQMQLCSQAAEELITRICDAATIHCLLEQELAHAVN
ACSHALNKANPKYPEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLESPHEERVSDAL
HSVEVELQKLTEIPWLYYIFHQNEDEEPPMDCTKRNKSAVFRIVPKFKKEKIPKQKASSP
HQKWGTEEVAALVLLHLGEYKETIIRRDIRAAELLHLERRDLKDLGIPKVGHMKRILQGI
KELGRSTAQSEA
Download sequence
Identical sequences ENSPCAP00000009360 ENSPCAP00000009360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]