SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000009830 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000009830
Domain Number 1 Region: 392-570
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.91e-47
Family BCR-homology GTPase activation domain (BH-domain) 0.000000022
Further Details:      
 
Domain Number 2 Region: 6-289
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 7.06e-47
Family BAR domain 0.037
Further Details:      
 
Domain Number 3 Region: 265-365
Classification Level Classification E-value
Superfamily PH domain-like 1.53e-18
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Domain Number 4 Region: 673-683,757-811
Classification Level Classification E-value
Superfamily SH3-domain 0.000000285
Family SH3-domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000009830   Gene: ENSPCAG00000010441   Transcript: ENSPCAT00000010536
Sequence length 812
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_4085:7546:339269:1 gene:ENSPCAG00000010441 transcript:ENSPCAT00000010536 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLPALEFSDCCLDSPHFRETLKSHEAELDKTNKFIKELIKDGKSLINALKNLSSAKRKF
ADSLNEFKFQCIGDAETDDEMCIARSLQEFATVLRNLEDERIRMXXXXXXXXXXXXXXXX
XXXXXXXXEAKKKYDKETEKYCGILEKHLNLSSKKKESQLQEADSQVDLVRQHFYEVSLE
YVFKVQEVQERKMFEFVEPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTRNRFE
GTRSEVESLMKKMKENPLEHKTVSPYTMEGYLYVQEKRHFGTSWVKHYCTYQRDSKQITM
VPFDQKSGGKGGEDESVTLKSCTRRKTDSIEKRFCFDVEAVDRPGVITMQALSEEDRRLW
MEAMDGREPVYNSNKDSQNEGMAQLDSIGFSIIRKCIHAVETRGINEQGLYRIVGVSSRV
QKLLSILMDPKTASETETDICAEWEIKTITSALKTYLRMLRPLMMYQFQRSFIKAAKLEN
QESRVSEIHSLVHRLPEKNRQMLQLLMNHLANVANNHKQNLMTVANLGVVFGPTLLRPQE
ETVAAIMDIKFQNIVIEILIENHEKIFNTVPDTPLTNAQLHLSRKKSSDSKPPSCSERPL
TLFHAVQPTEKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXPPNPSPTSPLSPSWPMFSAPSSPMPTSSTSSDSSPVRSVAGFVWFSVAAVVLSFAWSS
LHAVFSLLVNFVPCHPNLNLLFDRPEEEVHEDSSTPFRKAKALYACAEHDSELSXXXXXX
XXXXHPFQEPGWKEGTMNGKTGLIPENYVEFL
Download sequence
Identical sequences ENSPCAP00000009830 ENSPCAP00000009830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]