SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000009959 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000009959
Domain Number 1 Region: 262-355
Classification Level Classification E-value
Superfamily Immunoglobulin 3.77e-25
Family I set domains 0.0032
Further Details:      
 
Domain Number 2 Region: 999-1094
Classification Level Classification E-value
Superfamily Immunoglobulin 6.2e-23
Family I set domains 0.012
Further Details:      
 
Domain Number 3 Region: 427-480,789-848
Classification Level Classification E-value
Superfamily Immunoglobulin 8.46e-19
Family I set domains 0.031
Further Details:      
 
Domain Number 4 Region: 902-994
Classification Level Classification E-value
Superfamily Immunoglobulin 5.19e-17
Family I set domains 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000009959   Gene: ENSPCAG00000010590   Transcript: ENSPCAT00000010674
Sequence length 1098
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_2885:167:237627:1 gene:ENSPCAG00000010590 transcript:ENSPCAT00000010674 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSETSSRDSFYDSVSDLQEDGKNADFFPGLSAFLSQEEINKSLDLARRAIANSETEDLDS
EKEISQIFNPSPVSFRDSPSREDTQRGAQISGRPRETGPAPGQSRPEEQTRSIPSPAAKR
TPAASPLLARPSYIRSLRKAEKRSGKTPDPSGKPRPRGQGRAGPQSQLGDKAAHLIEELT
SIFRAAAKPRDRRSNGESSSPDSGYLSPPNQPSAPPRASASQRPGGEPRGAGGGDWARGS
GRGGAAPSPAQPRGAPRLPSAPRFTQKLRSQEVADGSRVCLECRVTGNPTPEVRWFSEGK
ELHSTPDIQIHCEGGDLHSLTIAEAFEDDTGRYTCLATNPSGSDTTSAEVFIEGASSSDS
DGESLAFKSKPGAMPQAQKKTTSVSLTIGSSSPKTGVTTAVIQPLSVPVQQVHSPTSHLC
RPDGTTPACFPPVFTKELQNITASEGQVVVLECRVRGALPLQVKWFRQGSEIQDSPDFRI
LQKKPRSTAEPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNTENSSYD
SMGEPNNDHSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGFPKKASRTARIAS
DEEIQGTKDAVIQDLERKLRFKEDLLNNGQPXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXEYKVSSCEQRLISEIEYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXIYWFKDGKQISPKSDHYIIQRDLDGTCSLHTTASTLDDDGNY
TIMAANPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPRSRSRDSADENEPIQERFF
RPHFLQAPGDLTVXXXXXXXXXXXXVSGLPTPDLSWQLDGKPIRPDSAHKMLVRENGVHS
LIIEPVTSRDAGIYTCIATNRAGQNSFSLELVVAAKEAHKPPVFIEKLQNTGVADGYPVR
LECRVLGVPPPQIFWKKENESLTHSTDRVSMHQDNHGYICLLIQGATKEDAGWYTVSAKN
EAGIVSCTARLDVYISRH
Download sequence
Identical sequences ENSPCAP00000009959 ENSPCAP00000009959

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]