SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000009970 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000009970
Domain Number 1 Region: 181-304
Classification Level Classification E-value
Superfamily Dystroglycan, domain 2 1.7e-60
Family Dystroglycan, domain 2 0.000000381
Further Details:      
 
Domain Number 2 Region: 497-598
Classification Level Classification E-value
Superfamily Cadherin-like 8.47e-19
Family Dystroglycan, N-terminal domain 0.016
Further Details:      
 
Domain Number 3 Region: 62-160
Classification Level Classification E-value
Superfamily Cadherin-like 1.51e-17
Family Dystroglycan, N-terminal domain 0.00000334
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000009970   Gene: ENSPCAG00000010741   Transcript: ENSPCAT00000010685
Sequence length 895
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_6097:64578:82405:1 gene:ENSPCAG00000010741 transcript:ENSPCAT00000010685 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRMSGSLLLLPPLWGRTFLLLLLVALAQSHWSSEPSETIRDWENQLEASMHSVLSDLREA
VPTVVGIPDGTAVVGRSFRVPIPTDLIASNGEVIKVSAAGKEALPSWLQWDPESHTLEGL
PLDTDKGVHYISVSAARLGANGSHIPHSSSVFSIEVYPEDHSEPLAVRAASPEPAEVVSS
TCAADEPVTVLTVILDADLTKMTPKQRIDLLHRMRSFSGVELHNMKLVPVVNNRLFDMSA
FMAGPGNAKKVVENGALLSWRLGCSLNQNSVPDIRGVEAPAREGTMSAQLGYPVVGWHIA
NKKPPLPKRIRRQIHATPTPVTAIGPPTTAIQEPPSRIVPTPTSPAMAPPTETMAPPVRD
RVPGKPTVTIRTRGAIIQTPTLGPIQPTRVPEAGTTVPGQIRPTVTIPGFVEPTAVATPP
AATTKKPRVSTPKPATPSTDSSTTTTRRPTKKPRTSRPVTRGTTKAPVTRLETASPPTRI
RTTTSGVPRGGEPNRPPELKNHIDRVDAWVGTYFEVKIPPDTFYDNEDTTTDKLKLTLKL
REQQLVGEKSWVQFNSNSQLMYGLPDSGHVGKHEYFMHATDKGGLSAVDAFEIHVHKRPQ
GDRAPARFSAKFVGDPAPVVNDIHKKITLVKKLAFAFGDRNCSTITLQNITRGSIVVEWT
NNTLPLEPCPKEQITGLSRRIAEDDGKPRPAFSNAVEPDFKAVSVAVMGSGSCRHLQFIP
VTSPRRVPSEAPPTEVPDRDPEKSSEDDVYLHTVIPAVVVAAILLIAGIIAMICYRKKRK
GKLTLEDQATFIKKGVPIIFADELDDSKPPPSSSMPLILQEEKAPLPPPEYPNQSVPETT
PLNQDTVGEYTPLRDEDPNAPPYQPPPPFTAPMEGKGSRPKNMTPYRSPPPYVPP
Download sequence
Identical sequences ENSPCAP00000009970 ENSPCAP00000009970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]