SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000010517 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000010517
Domain Number 1 Region: 907-1133
Classification Level Classification E-value
Superfamily RNI-like 7.06e-22
Family Cyclin A/CDK2-associated p19, Skp2 0.053
Further Details:      
 
Domain Number 2 Region: 61-160
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 0.000000179
Family Asparaginyl hydroxylase-like 0.079
Further Details:      
 
Domain Number 3 Region: 283-342
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 0.000000302
Family TehB-like 0.037
Further Details:      
 
Domain Number 4 Region: 612-678
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000699
Family PHD domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000010517   Gene: ENSPCAG00000011177   Transcript: ENSPCAT00000011263
Sequence length 1145
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_6070:16172:70812:1 gene:ENSPCAG00000011177 transcript:ENSPCAT00000011263 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ANSENISPAAERERGTMRRRYEDDGISDDEIEGKRTFDLEEKLHTNKYNANFVTFMEGKD
FNVEYIQRGGLRDPLIFKNSDGLGIKMPDPDFTVNDVKMCVGSRRMVDVMDVNTQKGIEM
TMAQWTRYYETPEEEREKLYNVISLEFSHTRLENMVQRPSTXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHAVYTPTDTLVFGGNFLH
SFNIPMQLKIYNIEDRTRVPNKFRYPFYYEMCWYVLERYVYCITNRSHLTKEFQKESLSM
DLELNGLESGNGDEDAVDREPRRLSSRRSVLTSPVANGVNLDYDGLGKACRSLPSLKKTL
SGDTSSDSGRGSHNGQVWDTQCSPRKDRQVHLTHFELEGLRCLVDKLESLPLHKKCVPTG
IEDEEALIADVKVLLEELAGSDPKLALTGVPIVQWPKRDKLKFPSRPKVRVPTIPITKPH
TMKPAPRLTPVRPAAASPIVSGARRRRVRCRKCKACVQGECGVCHYCRDMKKFGGPGRMK
QSCVLRQCLAPRLPHSVTCSLCGEVDQNEETQDFEKKLMECCICNEIVHPGCLQMDGEGL
LNEELPNCWECPKCYQEDSSEKAQKRKMEESDDEAVQAKVLRPLRSCDEPLTLPPHSLTS
MLQLIHDSVSPRGMVTRSSGAGPSDHHSASRDERFKRRQLLRLQATERTMVREKENNPSG
KKELSEVEKAKIRGSYLTVTLQRPTKELHGTSIVPKLQAITASSANLRHSPRVLVPHCPA
RAPQRGDEEGLGGEEEDGEEAEEDDDSAEEGGTARLNGRGSWAQDGDESWMQREVWMSVF
RYLSRRELCECMRVCKTWYKWCCDKRLWTKIDLSRCKAVVPQALSGIIKRQPVSLDLSWT
NVSKKQLTWLVNRLPGLKDLLLAGCSWSAVSALSTSSCPLLRTLDLRWAVGIKDPQIRDL
LTPPADKPGQDNRSKLRNMTDFRLAGLDITDATLRLIIRHMPLLSRLDLSHCSHLTDQSS
SAHRSGCNKLTDQTLIYLRRIFYVTLIDLRGCKQITRKACEHFISDLSISSLYCLSDEKL
IQKIS
Download sequence
Identical sequences ENSPCAP00000010517 ENSPCAP00000010517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]